KEGG   Orcinus orca (killer whale): 101288051
Entry
101288051         CDS       T05247                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04610  Complement and coagulation cascades
oor04810  Regulation of actin cytoskeleton
oor05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101288051 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101288051 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101288051 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:oor04515]
    101288051 (ITGAX)
   04090 CD molecules [BR:oor04090]
    101288051 (ITGAX)
Cell adhesion molecules [BR:oor04515]
 Integrins
  Integrin alpha subunits
   101288051 (ITGAX)
CD molecules [BR:oor04090]
 Proteins
  101288051 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 101288051
NCBI-ProteinID: XP_004268776
LinkDB
Position
Unknown
AA seq 1167 aa
MPMSDLPVMTRTRIFLLLSMALASSFCFNLDIDQPTTFHVDSAGFGYSVVQYASWLVVGA
PQEIKASNQTGGLYQCDYSTGKCEPILLPVPPEAVNMSLGLSMVATTSPFQLLACGPTVH
HACRENMHLTGFCFLLVSPSWQAQRIPAALQECPRQEQDIAFLIDGSGSISSTNFAKMLN
FVKAMMSQFQSPSSQFSLVQFSDKFQVHFNFKAFATSSNPLSLLNSVQKLNGYTHTATAI
RMVTEQLFSALYGARKDASKILIVITDGQKQRDPLDYKDVIPSAEAAGIIRYAIGVGSAF
QNIHSWQELKDIASKPSHEHIFKVENFDALRDIQNQLKEKIFAIEGTQTVSSSSFELEMS
QEGFSAVLMPDGPVLGAVGSFSWSGGAFLYPENRSPTFIHVSQEHADMSDSYLGYSTELA
VWKGVHSLVLGAPRHQHTGKVVIFTQVSGQWRLKAEVTGTQIGSYFGASLSSVDVDRDGS
SDLVLIGAPHYYEQSRGGQVSVCPFPRGRAKWQCGAVLRGEQGHPWGRFGAALTVLGDVN
GDRLMDVAIGAPGEQENQGAVYLFHGTSGLGISPAHSQRVTGAQFSPSLQYFGQSLSGGQ
DLTMDGLVDLAVGAWGHALLLRTRPVLRVWANLYITPPEITRSVYECHQQLAFAQSLGEA
VVCLRVSQSPKNRLANLQSIVTFDLTLDPGRMSPRAVFEETGTRNLTRVRDLGLTQHCEP
VRLLLPACVEDPVTPIILRLNFSLVGKPVSGFGNLQPMLAVDAQRYFMTSLPFEKNCGAD
HVCQDDLGISFGVSGLKTLIVGSNLELNLEVRVWNDGEDSYGTTITFFYPPGLSYRRVAG
GQNQLQSRAPRLNCDSAPTGSQGTLSTSCSINHLIFREGAQITFRATFDVSPTAMLGGRL
LLAANVSSENNTPKMSKTTFRLELPVKYAVYTMISSHEQSTKYLNFSASEEEESSGAQHR
YQVNNLGQRDLPVSIDFSVPVELNRLTVWKDMEVLHPQNPSIQCPSERTVPTESDFLTHF
QKKPVLDCSIAACLRFRCDIRSFSVQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEITF
NRSVYSQLPGQEAFLRAQMELVLEKYEVYNPTPIIVGSSVGGLLLLALITAILYKVGFFK
RQYKEMMEGANGQTAPENGTGDPQVAQ
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgcccatgtctgaccttccagtcatgaccaggaccaggattttcctcctcctgtcgatg
gccctggcttcctctttctgcttcaacttggacatagaccagccaacaaccttccatgtg
gacagtgctgggtttggatacagcgtggtccagtatgccagctggctggtggttggagcc
ccccaggagataaaggcttccaatcaaacgggcggcctctaccagtgcgactacagcacg
ggcaagtgtgaacccatcctccttccggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggtggccaccaccagcccctttcagctgctggcctgtggccccaccgtgcac
catgcatgcagggagaacatgcacttgaccgggttttgtttcctgctggtctccccatcc
tggcaggcccagaggatcccggctgccctgcaggagtgcccgaggcaggagcaggacatt
gccttcctgatcgatggttcaggcagcatctcctccaccaattttgccaaaatgctgaac
ttcgtgaaggctatgatgagccagttccagagtcccagctcccagttctccctggtgcag
ttctccgacaagttccaggtgcacttcaatttcaaagctttcgcaaccagctcaaaccca
ctaagcctgctgaactccgtacagaagctgaatgggtacacgcacacggccacagccatc
aggatggtcacagaacagctgttcagtgccttatatggggcccgaaaagatgcctccaaa
atcctcatcgtcatcaccgatgggcagaaacaacgtgaccctctggattacaaggacgtc
attcccagtgctgaggctgctggcatcatccgctatgcaatcggggtgggatcggctttt
caaaatatacattcctggcaagaattaaaggacatcgcatcgaagccctcccatgaacac
atatttaaagtggagaactttgatgctttgagagacattcaaaaccaactgaaagagaag
atctttgccattgagggtacgcagactgtaagcagcagttccttcgaactggagatgtcc
caggagggcttcagtgctgtgctcatgcctgatggaccagttctgggggctgtggggagc
ttcagctggtctggaggtgccttcctgtaccccgaaaataggagccccaccttcatccac
gtgtctcaggagcacgcggacatgagtgactcttacctgggttactccacagagctggcc
gtttggaagggggtacacagcctggtcctgggggccccccgccatcagcacaccgggaag
gttgtcatcttcacgcaggtgtccgggcaatggaggctgaaggctgaagtcacagggacc
cagatcggctcctacttcggggcctccctcagctccgtggacgtggacagagatggcagc
tccgacctggtcctcatcggggccccccattactatgagcagagccggggcgggcaggtg
tccgtgtgcccctttccccgggggagggctaagtggcagtgtggtgctgtcctgcgaggg
gagcaaggccacccctggggccgctttggggcagctctgacggtgctgggggatgtgaac
ggggacaggctgatggacgtggccatcggggccccgggagagcaggagaaccagggtgct
gtctacctgtttcacggaacctcaggactgggcatcagccccgcccacagccagcgggtc
acaggcgcccagttctcccccagcctccagtattttgggcagtcgctgagcgggggtcag
gacctcaccatggatggactggtggacttggctgtgggggcctgggggcacgcgctgctg
ctcaggaccagacctgtgcttagggtgtgggcaaacctctacatcacacctccagagatc
accaggtcagtgtatgaatgccaccagcagctggccttcgcccagtctctgggtgaggcc
gttgtctgccttcgtgtttctcaaagtcccaagaaccggctggctaacctccaaagcatt
gtgacctttgacctaacccttgaccctggccgcatgagtcctcgtgctgtcttcgaggag
acagggactcggaatctgactcgtgttcgagacctggggctgacacagcactgtgagccc
gtgaggttgctcctgccggcctgtgtggaggacccggtgacccccatcatcttgcgtctc
aacttctccctagtgggcaagcctgtctctggctttggaaacctccagcctatgctggca
gtggatgcccagagatacttcatgacctctctcccctttgagaagaactgtggtgctgat
cacgtctgccaggacgacctcggcatctcctttggggtctcaggcttgaagaccctgatt
gtggggagtaacctggagctgaacttggaagtgagagtgtggaatgatggagaggactcc
tatggaaccacaatcaccttcttctacccaccggggctatcttatcgacgtgtggcaggg
gggcagaaccagctgcagtcacgtgccccgcgcctgaactgtgacagtgcccccaccggg
agccagggcaccctcagcaccagctgtagcatcaaccacttaatcttccgtgagggcgcc
cagatcaccttcagggccacctttgacgtctcccccacggccatgctgggaggccggctg
cttcttgcagccaatgtaagcagtgagaataacacccccaagatgagcaagaccaccttc
cggctggagctcccagtgaagtacgccgtgtacaccatgatcagcagccatgaacagtcc
accaagtacctcaacttctcggcctccgaggaggaggaaagcagcggggctcagcacaga
taccaggtgaacaacctgggacagagggacctgcctgtcagcattgacttctcagtgccc
gtggagctgaatcggttgaccgtgtggaaggatatggaggtcctccaccctcagaaccca
tcgattcagtgcccttcagagagaacagtgcccacagagtccgacttcctgacccacttt
cagaagaagcctgtcctggactgctctattgctgcctgcctgaggttccgctgtgacatc
cgctccttcagcgtccaggaggaacttgacttcatcctgaaaggcaatctcagcttcggc
tgggtcagccagacactgcagaagaaggtgttggttgtgagtgtagctgagatcacattc
aacagatccgtgtattcccagcttccaggacaggaagcatttttgagagcccagatggag
ctggtgctggagaagtatgaggtctataaccccacccccattattgtgggcagctctgtg
ggaggactgctgctgctggctctcatcacagccatactgtacaaggttggcttcttcaaa
cgtcagtacaaggaaatgatggagggagcaaatggacagactgctccagaaaatgggaca
ggagacccccaagttgcccagtaa

DBGET integrated database retrieval system