Orcinus orca (killer whale): 101288714 Help Entry 101288714         CDS       T05247                                  Name (RefSeq) histone H2A-Bbd type 2/3-like   KO K11251   histone H2A Organism oor  Orcinus orca (killer whale) Pathway oor03082   ATP-dependent chromatin remodeling oor04217   Necroptosis oor04613   Neutrophil extracellular trap formation oor05034   Alcoholism oor05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oor00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101288714  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101288714  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101288714  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101288714   09165 Substance dependence    05034 Alcoholism     101288714  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oor03036]     101288714   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oor04147]     101288714 Chromosome and associated proteins [BR:oor03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101288714 Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101288714 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101288714 NCBI-ProteinID:  XP_004285992 LinkDB All DBs Position X:132016225..132016814 Genome browser AA seq 155 aa AA seqDB search MSGKRGRRGSPGRRSHTARAELSFSVSHMERLLREGHYAQRLSSSAPVYLVAIIQYLAAR VLELARHEAQNSSRRHLTPEPVDVAARSNALLSDLFRTIAPSPRWPWPSPSCPTTPGFPA PGGRGRQAPGPLTDQPHSPGGPGLPAALGTVTASQ NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtctgggaagaggggccgtcgagggtcacccggtcgccgctcccacaccgcccgagcc gagctgtccttctccgtgagccacatggagcgcctcctgcgggagggccactacgcccag cgcctgagctcgtctgcacccgtctacctagtggccatcatccagtacctggcggccagg gtcctggagctggcgcgccatgaggcccagaacagcagcaggaggcacctcactccggag ccggtggacgtggcggcccgcagcaacgcgctgctcagcgacttgttcaggactatagca ccatctcccaggtggccctggcccagccctagctgcccaacgacacctgggttcccggcc cccggggggcgcggccgtcaggcgccaggtccgctcaccgaccaaccgcacagcccgggc ggccccggcctgcctgccgccttgggcacagtcactgcgagtcaataa

DBGET integrated database retrieval system