KEGG   Ogataea parapolymorpha: HPODL_03843
Entry
HPODL_03843       CDS       T08137                                 
Name
(RefSeq) Myosin-13, skeletal muscle, extraocular
  KO
K12575  kinetochore protein SLK19
Organism
opa  Ogataea parapolymorpha
Pathway
opa04111  Cell cycle - yeast
opa04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:opa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    HPODL_03843
   04113 Meiosis - yeast
    HPODL_03843
SSDB
Motif
Pfam: Fungal_TACC Crescentin Filament Apolipoprotein TPR_MLP1_2 MAD ADIP DUF3142 CATRA-C ATG16
Other DBs
NCBI-GeneID: 25773277
NCBI-ProteinID: XP_013934091
UniProt: W1QE52
LinkDB
Position
V:125094..127400
AA seq 768 aa
MAKLSENSPSGAKTALKRIEHGLTYKHEIRKPSFRRRSLSPQKTQSLAVSPARVPLTCIK
EPLNSKLVPIALGKHDLTKALSTAEKENDDNNTTDTDKIEMLDVESDAVEVQSSPVGSHQ
NRMNSKRHMDTPLLVSDAKKMHLGDESFQTPLRPGSKKRVTPHREHHSRLMNDSDIDLHN
ASTENPVLDPQNSPLANVSHGQLLEDKIDGETEVIKGLKHRGTQINDISAIAADSSLDHH
DDTSDSEGEQDERMSPVKLSQKISALDVFSAMIDQEDEIEDFELVGGDEAEERPVFTNSQ
LEGIKSSMQSSIDALKEEVAVQSEKLASTETALASVSAQLETESGEKKHLLNEKAELIVE
LQSYKQSIQLSNSKISQLESRVKFYESKLEKLKTIYSQLMGTAKNFESELTDKTARITDL
EISVTSLKEEKTVLSNEKIELSSALELRLNEIEQLTKEKESLENQLKNVSSSSESALKKT
EDLVRELDSKTKDAAELREKLDEQAVKIEGLELDLSQATEKLNAYQDELRSGVDKIIALE
NELSAVRSELESLQEKETLLVDENTSLKEVMGHRRDEIKRLKAEKEELSQQLSSRKDQNT
EELLEKLREEMSALRGSTEAQINELSANLDAKNEKLVEAKTEASTMKQKVATLESQLADA
NAKIQEHDKNLEQQLEKLAQDLYLQYSAKHEQKVAILKKGYEMKWMNKLKKLSKENEQLR
SEVESFKRRLEVENNEKKQLVKLWEEYVSLESNDKANALPDFIKKAED
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggcaaagctcagcgaaaatagccccagcggagctaagaccgcgctcaagcggattgaa
cacggtctcacgtacaagcatgaaatcagaaagcccagcttcagacggcggtcgctgtcg
ccccagaaaacgcagtccctcgcagtttcccctgccagagtgcctttgacctgtatcaaa
gagcccctcaacagcaaattggttccaattgcgctcggaaaacacgatctgacgaaggcc
ttgagcacggcagagaaggaaaacgacgacaataacaccaccgacaccgataagattgag
atgctcgacgtggagtcggacgcggtcgaggtgcagtcttcgccggtggggtctcaccaa
aatagaatgaattccaaaagacacatggacactccgctacttgtctcggacgcgaagaag
atgcatttgggggacgaatcgttccagactccgctgagaccgggctccaagaagcgcgtg
accccccacagagaacaccacagtcggctgatgaacgattcggacatcgatttgcacaac
gcctccactgagaatcctgtgctcgatccgcagaacagcccactcgccaacgtgagccac
ggacaactactcgaggacaagatagacggcgagacagaggtgatcaagggactcaaacac
aggggtacacagatcaacgacatttctgcgattgcggccgactcgtcgctagaccaccac
gacgacacctcggactcagagggtgagcaggacgagagaatgtcgcctgtcaagctttca
cagaaaatctctgccctggacgtcttcagcgccatgattgatcaggaagacgaaatcgag
gatttcgagcttgttggcggcgacgaagcggaagaaaggccggtgttcacaaattctcag
ctggaagggattaagtcttccatgcagagtagcattgacgcgttgaaagaggaagtggca
gtccaatcagagaagcttgcttctacagaaaccgcattggcctctgtttctgcgcaatta
gagaccgagtctggagaaaagaaacatctgttgaacgaaaaggccgagcttattgttgag
cttcaatcatacaagcagtcaatccaattgtcaaattccaaaataagccaattggaatcc
agagtcaaattctacgagtccaagcttgagaagctgaaaacaatctacagtcaactgatg
ggaacggcaaaaaacttcgagtctgagctcacagacaagaccgcacgcatcaccgattta
gagatatccgtcaccagtttgaaggaggagaaaaccgtgttatccaacgaaaaaattgaa
ctttcgtctgcgctggagctgagattgaacgagatcgagcaactgactaaagagaaagag
tcgcttgaaaaccaactaaagaatgtgtcaagcagttccgagtctgccctgaagaagacg
gaggatcttgtcagggagctagattcaaaaacaaaggatgcggccgagctgcgtgagaag
cttgacgagcaagcagtcaagatcgagggtcttgaactcgacctcagccaagccaccgag
aaactcaacgcataccaagacgagctgaggtctggcgtggataaaatcattgcactggag
aacgaactgagtgccgtgcgttcagagctcgagtctctgcaggagaaggagactttactg
gtagatgaaaacacgagtctgaaagaggtcatgggacaccgtcgcgacgagatcaagcgt
cttaaggccgagaaggaggagctgagccagcaattgagcagccgcaaggaccagaacacc
gaggagctgctggaaaagctgcgggaagagatgtctgcgctgcggggcagcacggaggcc
cagatcaacgagctgagcgctaatctggatgccaagaacgaaaagctggtggaagccaag
acggaggcctcgacaatgaaacagaaagtggccacgctagagagccagctcgcagatgcc
aacgccaagatacaggagcacgacaagaacctcgaacagcagctggagaagctggctcag
gatctatatttgcagtattctgccaaacatgagcaaaaggttgcaattctgaagaagggc
tacgagatgaaatggatgaacaagctcaagaagctgagcaaagagaacgagcagctacgc
agcgaggtggagagcttcaagagacggctggaggtcgagaacaacgaaaagaagcagctg
gtaaagctctgggaggagtatgtgtccttggagagcaacgataaggcaaacgctttgcct
gatttcattaaaaaagctgaggattga

DBGET integrated database retrieval system