KEGG   Ochotona princeps (American pika): 101523366
Entry
101523366         CDS       T07609                                 
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
opi  Ochotona princeps (American pika)
Pathway
opi04610  Complement and coagulation cascades
opi04810  Regulation of actin cytoskeleton
opi05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:opi00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101523366
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101523366
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101523366
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:opi04515]
    101523366
   04090 CD molecules [BR:opi04090]
    101523366
Cell adhesion molecules [BR:opi04515]
 Integrins
  Integrin alpha subunits
   101523366
CD molecules [BR:opi04090]
 Proteins
  101523366
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 101523366
NCBI-ProteinID: XP_004586972
LinkDB
Position
6:complement(24334901..24350824)
AA seq 1161 aa
MTRTSTALLLSAAVASVLCFNLDTEQPSTFRMPSAGFGHSVAQYDGSWVVVGAPQEITAP
NQTGSLYQCKYGTDTCEPIYLQVPPEAVNMSLGLSLAAATKPSRLLACGPTVQHACKENI
YLTGLCFLLSHSFQLSQRLPAAMQECPRQEQDIAFLIDGSGSIAPSNFVIMLNFVRAVMT
QFSRPSTQFSLVQFSYRFHMHFNFNNFISSSDPLSLLDSVPQLRGATHTASAIQWVVQHV
FTAYNGARKDATRILIVITDGQKYRDPLDYPAVIPLAEAAGIIRYAIGVGSAFQSSYSRK
ELDDIASEPSREHVFRVDDFDALREIQNQLKEKIFAIEGTETTRSSSFEQEMAQEGFSAL
FMPGGPVLGAVGSFTWSGGAFLYPTGWNPTFINMSQDNVDMRDSYLGYSSELALWKGVQN
LVLGAPRYQHTGKVVLFTQTSAQWEPRTEVVGTQVGSYFGASLCSVDVDRDGNTDLVLIG
APHYYEQTRGGRVSVCPLPKGRALWHCPAILRGEQGQPWSRFGAALTVMGDVNGDELTDV
VIGAPGEQENRGAVYLFHGTPELDISPTYSQRITGSQLSSGLQYFGQSLSGGQDLTGDGL
VDLAVGALGQALLLRTRPILRVKVDMGFTPTEVARSVFECQEQAASKQALGNATVCLHVY
EHSKTQLGDLQSAVTFDLALDPGRLSPRAVFKETSLWTLRRQQVLGLKQHCETVPLLLQA
CVEDVVTPIILRLNFSLVGNPLHSFGHLRPILAVDAQRYFTASLPFEKNCGADHICQDDL
AISFSVSGLKTLIVGNHLELDLDVTVRNDGEDSYGTTVTFSYPAGVSYRRVARIQAQSQL
HSPSMTCDSIIPLGSQDATSTSCSLKHLIFRGGTQITFLATFDVSPRAKLGNRLLLTANV
SSENNTPRTSKSFFQLELPVMYAVYMLVSSHEQSTRYFNFSASEKAGSSVAQHRYQVNNL
GQRDLPLSINFWVPVELNGAAVWTEVKVSQPQNQAVRCSSEKVAPPAPGIGTDIQKSPVL
DCSAAHCLRFRCHVPSFGIQEELDFMLNGTLSFAWLSQMPQKKVSVVSMAELTFDRSVYS
QLPGQEMFLRAQVETVLEEYQVHNPVPLVVGSCVGGLLLLALISALLYKVGFFKRQYKEM
MEEANGQIVPENALPDPQVAQ
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgaccaggaccagcacagccttgctgctgtctgcagccgtggcttctgttctctgcttc
aatttggacacggagcagccaagcactttccgcatgcccagtgctggctttggacacagc
gtggcccagtacgacggctcgtgggtggtggttggagccccccaggaaataacggcgccc
aaccagacaggtagcctctaccaatgcaaatacggcacggacacatgtgagcccatctac
ctgcaggtcccccctgaggctgtgaacatgtccctgggcctgtccctggcagctgccacc
aagccctcccggctgctggcctgtggtcccacggtgcagcatgcatgcaaggagaacata
tacttgactgggctgtgtttcctgctgagccactccttccagttgtcccagaggctcccg
gctgccatgcaagagtgccccaggcaggagcaagacattgcattcctgattgacggctcg
ggcagcatcgcccctagtaactttgtcatcatgctgaacttcgtaagggccgtgatgacc
cagttctccagacccagcacccaattctccctggtgcagttctcctatcgtttccatatg
cacttcaacttcaacaacttcatctccagctcagaccctctaagcttgttggattctgtg
ccgcagttacggggggccacccacacggcttcagccatccaatgggttgtacagcatgtg
ttcactgcctacaacggggcccgcaaagatgccaccaggatcctcatcgtcatcaccgat
ggccagaagtatagagaccccttggattacccagcagtcatccccctggctgaggcagcc
ggcatcattcgctatgcaattggggtgggatctgctttccaaagcagctattcccggaag
gaattagatgacatcgcctcggagccctccagagaacacgtatttagagtggacgacttt
gatgcattgagggaaattcaaaaccagctgaaggagaagatctttgccattgaggggacg
gagaccaccaggagcagctcctttgagcaggagatggcccaggagggcttcagtgcactg
tttatgcctggtggcccagtgctgggagctgtgggcagcttcacctggtctgggggcgcc
tttctgtatcccacgggttggaatcccaccttcatcaacatgtctcaggacaacgtggac
atgagggactcatacctgggttactccagtgagctggccctttggaagggggtgcagaac
ttggttctgggggcaccgcgctaccagcacaccgggaaggtcgttctcttcacccagact
tccgcgcagtgggagccgaggaccgaggttgtgggaacccaggttggctcctacttcggg
gcctccctgtgctcagtggacgtggacagagatggcaacactgacctggtcctcattggg
gccccccactactacgagcagacgcgaggtggccgcgtgtctgtgtgtcctttgccaaag
gggcgggctctgtggcactgcccggccattctccgtggggaacagggccaaccctggagc
cgctttggggcagctctaacggtgatgggggatgtgaatggagatgagctgacagacgtg
gtcatcggggccccaggagagcaagagaatcggggtgcagtctatctgttccatggaacc
ccagagctggacatcagccccacctatagccagaggatcacaggctcccagctgtcctct
gggctccagtatttcgggcagtctctgagcgggggacaggacctcactggggatggcctt
gtggacctggccgtgggggccctgggacaagcgctgctgctcaggaccagacctatcctc
agggtaaaggtggacatgggcttcacacctaccgaggtggcaaggtctgtgtttgagtgt
caggagcaggcagcctctaagcaggccctggggaatgccaccgtctgccttcatgtttac
gaacattccaagacccagctgggtgatctccaaagtgctgtgacctttgaccttgccctg
gaccctggccgactgagtccccgcgctgtcttcaaggagacaagcctgtggactctgagg
cgacagcaagtcctggggctgaagcagcattgtgaaacggtgccactgctcctccaggcc
tgcgtggaggatgtcgtgacccccatcatcttgcgtctcaacttctctctggtgggcaac
cccctccattcctttggacacctccggcccatactggccgtggatgctcagagatatttc
acggcgtctcttccctttgagaagaactgtggagctgaccacatctgccaggatgacctc
gccatctccttcagcgtctcaggcttgaagactctgatcgtggggaaccacctggagctg
gacctggacgtgactgtacggaatgatggtgaggactcctatggaaccacggtcaccttc
tcctatccggctggggtgtcctatcggcgcgtggcaaggatccaggcccagagtcagcta
cattccccgagcatgacatgtgacagcatcattcccttggggagccaggatgccaccagc
accagctgcagcctcaagcaccttatcttccgcgggggcacccagatcaccttcttggct
accttcgacgtctcccctagggccaagctgggaaaccggctgcttctgacagccaatgtg
agcagtgagaataacacgcccaggaccagcaagagctttttccagctggagctgccggtg
atgtatgctgtctacatgctcgtcagcagccatgagcagtccaccaggtacttcaacttc
tcggcctcagagaaggctggcagcagcgtggcccagcacagataccaggtcaacaacctg
ggacagagggacctgccactcagcatcaacttctgggtgcctgtggagctgaatggggct
gccgtgtggacggaggtgaaggtgtcccagcctcagaaccaggctgttcggtgctcttcg
gagaaagtagctcccccggcgcctggcatagggacagacattcagaagagccctgtgctg
gactgcagtgcagcccactgcctgaggttccgctgccacgtcccctccttcggcatccag
gaggagctagacttcatgctgaatggcaccctcagctttgcctggctcagccagatgcca
cagaagaaggtgtcggtggtgagcatggctgagctgaccttcgacaggtctgtatactct
cagcttccaggccaggagatgttcttgagagcccaggtggagacggtgctggaggagtac
caggtgcacaatcccgtgcccctggtggtgggcagctgtgtgggtggcctcctgctgctg
gctctcatctcagccctgctgtacaaggtgggcttcttcaaacgtcagtacaaagaaatg
atggaggaagcaaatgggcagattgttccagaaaatgcactaccggacccccaagtggcc
cagtga

DBGET integrated database retrieval system