KEGG   Ochotona princeps (American pika): 101523469
Entry
101523469         CDS       T07609                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
opi  Ochotona princeps (American pika)
Pathway
opi04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:opi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101523469 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:opi04050]
    101523469 (TNFRSF8)
   04090 CD molecules [BR:opi04090]
    101523469 (TNFRSF8)
Cytokine receptors [BR:opi04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101523469 (TNFRSF8)
CD molecules [BR:opi04090]
 Proteins
  101523469 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101523469
NCBI-ProteinID: XP_012785461
LinkDB
Position
13:complement(14657072..14705879)
AA seq 589 aa
MCALRPALGLLLLGALQAFPQNRAPRDLCAEDLGLYYDKAAGSCCYRCPSGLVPAQLCPQ
GLAGCRKHCDPDYYLNEAGRCVACVSCSSDDLVEKAPCSWNSSRICECRPGMYCVTSAAN
SCARCQPRPACPPGTVNRSPGAAQDAVCEPPSPASSPDCASLEGCKAPTSGTTPQAQPTL
RSPNTTRPTLPRGTAPPAVEAASGPPRTWPSPSTQPSADPDPGLSPTLLCPQGSPTCQKQ
CQPDHYLDGTGHCMACVSCLHDDLVEKAPCSWNSSRICECRPGMYCAKSAANSCARCQPL
PICPPGTVTDPQGAAERGTTSEPPPPGSHPACRPTPEDNDTPVSVPTLSSRLDAHSSSVS
TPVSSSTRKPILDPGPVLFCVILVLAVALGSSSLLLCHRRACRKQIWQKLHLCKPTQTFQ
PTAELEASVDWGPEEGWAQNGRAKPRSDVVMTELDPKPPVETCQNVGTTCPEDLPLLKTA
LARGPSSSWELPEHRVSTENTNNKIEKIYIMKADTVIVGTVKTEASEGWAVAGTAEPTAA
VLEEQLEVDHAPHYPEQETEPPLGSCGDVMFSVEEEGKEDPLPTMVSEK
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgtgcgctctccgcccggcgctggggctcctgctcctgggggcgctgcaagccttccca
cagaatcgcgcccctagggacctctgtgctgaagacctcggactctactatgacaaggct
gctgggagctgctgctaccgctgcccctcggggctggtcccggcgcagctgtgcccgcag
gggctcgcgggctgcaggaagcactgtgaccccgattactacctgaatgaagctggccgc
tgcgtagcctgtgtgagctgctcttcagacgaccttgtggagaaggcgccctgctcctgg
aactcctcccgcatctgcgagtgtcgaccgggcatgtattgcgtcacgtccgctgccaac
tcctgcgcccgctgccagccccgccctgcctgtcccccagggacagtcaacaggtcccca
ggcgcggcccaggacgctgtgtgtgaaccgccttcgccagcctccagccctgactgtgcc
agcctggagggctgcaaggcgcccaccagcggcaccacgccccaggcccagcccacgctg
aggtcccccaataccaccaggcccacgctgcccagagggactgcccctcctgcagtagag
gctgcttctggacccccaaggacctggccctcccccagcacccagcccagtgcagaccca
gacccagggctgtctccgacgctgctgtgcccacaggggtctcccacctgccagaagcag
tgccagccagaccactacctcgatgggaccggccactgcatggcctgtgtgagctgcttg
cacgatgaccttgtggagaaggcgccctgctcctggaactcctcccgcatctgcgagtgt
cggccgggcatgtactgtgccaagtccgctgccaactcctgcgcccgctgccagcccctt
cccatctgtcccccagggacagtcaccgacccccagggtgcggctgagaggggcaccacc
tccgagccacctcccccagggagccaccctgcctgcaggcccacccctgaggacaatgac
acacctgtcagcgtgcccacgctcagctcccgcctggacgcccacagcagctccgtgagc
acccccgtctcctcctccaccaggaagcccattctggatccaggccccgtactcttctgc
gtgatcctggtgctggcggtggcacttggttctagctccttgctgctgtgccaccggagg
gcctgcaggaagcagatctggcagaagctgcacctgtgcaaaccgacccagacctttcag
cccacggccgagctagaggcatccgtggactggggacctgaggagggctgggcccagaac
gggagagccaagccaaggagtgatgtagtgatgacagagctggaccccaagccccctgtg
gagacctgtcaaaatgtgggcaccacctgccctgaggacctcccactgttgaagactgcc
ctggccaggggcccctcgtcctcctgggagctgccggagcaccgtgtgtctacggagaat
accaataacaagatcgagaagatctacatcatgaaggctgatacggtgattgtggggaca
gtgaagactgaggcatctgagggctgggctgtggctgggacagccgagccgacggcggcg
gtgctggaggaacagctggaggtggaccatgcgccccactacccggagcaggagacggag
ccgcccctgggcagctgtggcgatgtcatgttctccgtggaggaggaggggaaggaagac
cccttgcccacgatggtctctgagaagtga

DBGET integrated database retrieval system