Ochotona princeps (American pika): 101531238 Help Entry 101531238         CDS       T07609                                  Name (RefSeq) histone H2A type 1-H-like   KO K11251   histone H2A Organism opi  Ochotona princeps (American pika) Pathway opi03082   ATP-dependent chromatin remodeling opi04217   Necroptosis opi04613   Neutrophil extracellular trap formation opi05034   Alcoholism opi05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:opi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101531238  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101531238  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101531238  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101531238   09165 Substance dependence    05034 Alcoholism     101531238  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:opi03036]     101531238   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101531238 Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101531238 Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101531238 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101531238 NCBI-ProteinID:  XP_004599893 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLL NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgcggcaagcaaggaggaaaagctcgcgccaaggccaagactcgctcttcc agggccggcctgcagttcccggtgggcagagttcaccggctgctgcgcaagggaaactat tccgagcgcgtcggagctggtgcgcccgtgtacctggcggccgtgctcgagtacctgacg gctgagatcctggagctggcgggcaacgcggcgcgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctg

DBGET integrated database retrieval system