KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374484
Entry
101374484         CDS       T05148                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04610  Complement and coagulation cascades
oro04810  Regulation of actin cytoskeleton
oro05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101374484 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101374484 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101374484 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:oro04515]
    101374484 (ITGAX)
   04090 CD molecules [BR:oro04090]
    101374484 (ITGAX)
Cell adhesion molecules [BR:oro04515]
 Integrins
  Integrin alpha subunits
   101374484 (ITGAX)
CD molecules [BR:oro04090]
 Proteins
  101374484 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 101374484
NCBI-ProteinID: XP_004417041
UniProt: A0A2U3X456
LinkDB
Position
Unknown
AA seq 1162 aa
MTRTRTSLLLLMALASSLCFNLDTDQPKTFLMDSAGFGQSVVQYGNTWVVVGAPQEIKAA
NQTGSLYQCDYSMGKCEPIHLQIPPEAVNMSLGLTLAASTNPSQLLACGPTVHHTCQENM
YLTGFCFLLGSSSWQAQRLPAALQECPRQEQDIVFLIDGSSSISFRDFRKMLNFVEAVMS
QFQRPSTQFSLMQFSNNFRVHFTFKDFTYSSNPLVLLDSVRQLGGYTHTATAIQMVTNEL
FRTSGGARKDASKILIVITDGQKQGDRLGYKDVIPMAEAAGIIRYAVGVGSAFQNRLSWE
ELNDIASKPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQEGFSAV
FIPDGPVLGAVGSFSWSGGAFLYPPNMNPTFINMSQENVDMRDSYLGYSTELALWKGVQS
LILGAPRHQHTGKAVIFTQASGQWRPKAEVAGTQIGSYFGASLCTVDVDGDGSSDLVLIG
APHYYKLTRGGQVSVCPLPQGRAKWQCEVILCGEQGHPWGRFGAALTVLGDVNGDKLTDV
AIGAPGEQESRGAVYLFHGTSGLGISTSHSQRISAYQLSPSLQYFGQSLSGGQDLTQDGL
VDLAVGAYGQVLLLRTRPVLRVWMSIRFKPAEIARSLFECREETSSVNALGDANVCLHIY
ESPKNRLGDLQSSVTFDLTLDPGRQSPRAIFEETKTWNLTRVRVLGLRQHCETVKLLLLA
CVEDSVTPITLRLNFSLVGKPIPSFGSLRPMLAVDAQRYYTASLPFEKNCGTDHVCQDDL
GISFGFSGLKTLLVGSTLEMNMKVMVWNDGEDSYGTTVTFFYPPGLSYRRVAQGERQSQL
RPHSPHLTCDGTPAQGQGIQSTRCSINHLILPEGAQVTFLVTFDVSPKAMLGDRLLLTAN
VSSENNTPRTSKSTFQMELMVKYAIYTMISSHEQSTKYLNFSASDQEESNQAQHRYQVNN
LGQRDLPISIIFSVPVELNGVPVWRELEVFHPQNPSIQCSSERIVHRESDFLTHIQKNSV
LDCSTADCLRFCCDLPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEITFNRSVY
SQLPGQEAFLRAQVETVLEKYEVYNPIPIIVGSSVGGLLLLALITAILYKVGFFKRQYKE
MMAEANGQTVPENGTSDPQAAQ
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgaccaggaccagaacatccctcctcctgttgatggccttggcttcttctctctgcttc
aacttggacacagaccagccaaaaaccttccttatggacagtgctggatttggacagagc
gtggtccagtatggcaatacctgggtggtggttggagccccccaggagataaaggctgcc
aaccaaacaggcagcctctaccagtgtgactacagcatgggcaagtgtgagcccatccac
ttgcagattcccccagaagctgtgaacatgtccctgggcctgaccctggcagcctccact
aacccctctcagttgctggcctgtggccccacagtgcaccatacatgccaagagaacatg
tacttgactggattctgcttcctgctgggctcctcttcctggcaagcccagaggctccca
gctgccctgcaggagtgtccaaggcaagagcaagatattgtgttcctgatcgacggctca
agcagcatctccttccgtgattttagaaagatgctgaattttgtggaggctgtgatgagc
cagttccagagacctagcacccagttctccctgatgcagttttccaacaatttccgggtg
cacttcactttcaaagacttcacatacagctcaaacccactagtcctgttggattctgta
cgccagctgggagggtatactcacacagccacagccatccaaatggtcacaaatgaactg
ttccgtacctcaggaggggcccgaaaagatgcctccaagatcctcattgtcatcaccgat
gggcaaaaacaaggcgaccgcctgggttataaggatgtcatccctatggctgaggctgcg
ggtatcatccgttacgcagttggggtgggatcggcttttcaaaatagactttcctgggaa
gaattaaatgacattgcatcgaagccctcccatgagtacatttttaaagtggagaatttt
gatgctttgagagacattcaaaaccaactgaaagagaagatctttgccattgagggtacg
cagacgataagcagtagttcctttgaattggagatgtcccaggagggcttcagcgctgtg
ttcatacctgatggaccagttctgggggctgtggggagcttcagctggtctggaggtgcc
ttcctgtaccccccaaatatgaaccccacgttcatcaacatgtctcaagagaatgtggac
atgagggactcttacctgggttattccactgagttggctctttggaagggggtccagagc
ctgatcctgggggccccccgccatcaacatactgggaaggctgtcatcttcacccaggca
tctgggcaatggaggccgaaggctgaagtcgcagggactcagattggctcctactttggg
gcctccctctgcactgtggatgtggatggagatggcagctctgaccttgtcctcataggg
gctccccattactacaagctgacccgggggggccaggtgtctgtgtgccccttgccccaa
gggagggctaagtggcagtgtgaggtcattctctgtggggagcagggccacccctggggc
cgctttggggcagccctgacagtgctgggggatgtgaatggggacaagctgacagacgtg
gccattggggccccgggagagcaggagagccggggtgctgtctacctatttcatggaacc
tcaggactgggcatcagcacctcccacagtcagaggatctcagcctaccagctctccccc
agcctccagtattttgggcagtcactgagtgggggtcaggacctcacccaggatggactg
gtggacctggccgtgggggcctatgggcaggtgctgctgctcaggaccagacctgtactc
agggtgtggatgagcatccgattcaaacctgcagagatagccaggtctctgtttgagtgt
cgggaggagacctcctctgtcaatgcactgggcgatgccaatgtctgtcttcatatttat
gaaagtcccaagaatcggctgggtgacctccaaagctctgtgacctttgacctgaccctc
gacccaggccgccagagtcctcgtgccatctttgaggagacaaagacctggaatctgact
cgtgtccgagtccttgggctgagacagcactgtgagactgtgaagttgcttctcctggcc
tgtgtggaggactcagtgacccccatcaccttgcgtctcaacttctccctggtgggcaag
cctatcccttcctttggaagcctccggcctatgttggctgtggacgctcagagatactac
acagcctctctcccctttgagaagaattgtggaactgaccatgtctgccaggatgacctt
ggcatctcctttggcttctcaggcttgaagacgctgttggtggggagtaccctggagatg
aatatgaaagtgatggtgtggaatgacggtgaggactcctatggaaccacagtcaccttc
ttctacccaccagggctgtcttatcgacgtgtggcacagggggagcggcagagccagctg
cgaccacactccccacacctgacctgtgatggcaccccagcccagggccagggtattcag
agcacccgctgcagcatcaaccacctcatcctccctgagggtgcccaggtcaccttcttg
gtcacctttgatgtctcccccaaggccatgctgggagaccggctgcttctgacagctaat
gtgagcagtgaaaataacactcccaggaccagcaagagcacctttcagatggagctcatg
gtgaagtatgccatctacaccatgatcagcagccatgaacagtccaccaagtacctcaac
ttctcagcctcagaccaggaggaaagcaaccaggctcagcatagataccaggtgaacaac
ctgggacagagggacctgcctatcagcatcatcttctctgttcctgtggaactgaatggg
gtacctgtgtggagagaattagaggtcttccacccccagaatccctccattcagtgttct
tcagagagaatagtgcacagagagtctgacttcctgacccacattcagaaaaattctgtg
ctggactgctccactgctgactgtctgaggttctgctgtgacctcccctcctttggcatt
caggaggaacttgacttcatcctgaagggcaacctcagttttggttgggtcagccagaca
ctgcagaagaaggtattggtggtgagtgtggctgaaatcacattcaacagatctgtgtat
tcccagcttccaggacaggaggcattcttgagagctcaggtggagacggtgctggagaag
tatgaggtctacaaccccatccccattattgtgggcagctctgtgggagggctgctgctg
ctggctctcatcacagccatcctatacaaggttggcttcttcaaacgtcagtataaggaa
atgatggccgaagccaatggtcagactgtcccagaaaatgggacttcagaccctcaagct
gcccaataa

DBGET integrated database retrieval system