KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374661
Entry
101374661         CDS       T05148                                 

Gene name
IL33
Definition
(RefSeq) interleukin-33
  KO
K12967  interleukin 33
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04217  Necroptosis
oro04623  Cytosolic DNA-sensing pathway
oro05164  Influenza A
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101374661 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101374661 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    101374661 (IL33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101374661 (IL33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101374661 (IL33)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101374661 (IL33)
SSDB
Motif
Pfam: IL33 AbfB LytTR Cullin_Nedd8 Chordopox_A13L
Other DBs
NCBI-GeneID: 101374661
NCBI-ProteinID: XP_012422980
UniProt: A0A2U3ZVH8
LinkDB
Position
Unknown
AA seq 267 aa
MKTKMKYSTTKISPAKMNSSASKALVKSPKLRKSQQKAEEVCHMYFMQLRSGLIIEKTAC
YFRKEITKRHPPRTAEKYKEHHVVFTACRQQLKKDFACEVPMVQKCIGATNIPSIQEYSA
SLSTYNDQSITFVFEDGSYEIYVEDVGKDQEKDKVLFRYYDSQSPSHETGDGVDGQTLLV
NLSPTKDKDFLLHANNKEHSVELQKCENQLPDQAFFRLHRKSSKCVSFECKNNPGVFIGV
KDNHLALIKVGDQTEDSSIENTIFKLS
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaaaactaaaatgaagtattcaaccaccaaaatctccccagcaaagatgaacagttca
gcaagcaaggctttggtaaaatctcccaagctgagaaaatcccaacagaaagctgaagaa
gtttgccacatgtattttatgcagctgcgctctggccttatcatagaaaagacagcctgt
tattttaggaaagaaatcaccaaaaggcatccaccaagaacagctgaaaagtacaaagag
caccatgtggtattcactgcttgtcgtcagcagctaaagaaagactttgcctgtgaggta
cctatggtccagaaatgtattggagcaactaatattccgagtatccaagaatattctgct
tccctgagcacatacaatgaccaatctattactttcgtgtttgaggatggaagttatgag
atctatgtagaagacgtgggaaaagaccaagagaaagataaggtgttattccgttattat
gattctcaatccccctctcatgaaacaggtgatggtgttgatggccagacattattggta
aacctgagtcctacaaaagacaaagattttttgctgcatgccaacaacaaggaacactct
gtggagctacaaaaatgtgaaaatcaattgccagaccaggccttcttccgcctccatagg
aagtcttctaaatgtgtctcatttgaatgtaagaacaatcctggagtgtttataggagta
aaggataaccaccttgctctaattaaagtaggggaccaaactgaggattcgagtatagag
aataccatatttaagctttcttaa

DBGET integrated database retrieval system