KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275272
Entry
107275272         CDS       T01015                                 
Name
(RefSeq) peroxidase 70-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107275272
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107275272
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107275272
NCBI-ProteinID: XP_015616222
LinkDB
Position
11:12354702..12357591
AA seq 226 aa
MMAPPRPASRSRTQRHRLSAPFMVLLFLALATSSTVANAQLSDSYYDASCPAALLTIRTV
VSAAVLLDPRMGASLLRLHFHDCFVQGCDASVLLDDTGSFTGEKGAGPNAGSLRGFEVVD
NAKTLLETVCPQTVSCADILAVAARDAVVQLGGPSWTVLLGRRDSTTASASLANSDLPAP
SSTLATLLAAFSNKGLTTTDMVVLSGPSLPIKHGVHEGSKFKILRT
NT seq 681 nt   +upstreamnt  +downstreamnt
atgatggctcctcctcgtccagcttctcgcagtcgcacgcagcggcaccgtttgtctgcc
ccattcatggtcctcctgttccttgcactggccaccagcagtacagtagccaacgcccaa
ctgtccgacagctactacgacgcttcctgcccggccgcgctgctcaccatcaggaccgtc
gtgtcggcggcggtgctgctcgacccccgcatgggcgcctccctcctccgcctccacttc
cacgactgcttcgtccagggctgcgacgcgtcggtgcttcttgacgacactggcagcttc
accggcgagaagggcgccgggccgaacgccgggtcgctgcgcgggttcgaggtggtcgac
aacgccaagacgctgctggagacggtgtgcccgcagaccgtctcgtgcgccgacatcctc
gccgtcgccgcccgcgacgccgtcgtccagctcgggggcccgtcatggacggtcctcctg
gggaggagggactccaccacggcgagcgcgtcgctggccaacagcgacctccccgcgccg
tcctccaccctcgccactctcctcgccgctttctccaacaagggactcaccaccaccgac
atggttgtcctctcgggtccatctttgcctattaaacatggggtacatgagggtagcaag
ttcaaaattctccgtacgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275849
Entry
107275849         CDS       T01015                                 
Name
(RefSeq) cationic peroxidase 1-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107275849
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107275849
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107275849
NCBI-ProteinID: XP_015619393
UniProt: Q5U1F7
LinkDB
Position
12:614299..616050
AA seq 317 aa
MASPKPFACSAIALLFAANLVSAQLSANFYDKSCPNALPTIRIAVRSAIARENRMGASLL
RLHFHDCFVNGCDGSVLLDDTPTFTGEKTAAPNNNSLRGFDVIDNIKAHIEGICPQVVSC
ADILAVAARESVVALGGPTWVVQLGRRDSTTASLDTANNDIPAPTFDLGDLTKSFSNKGL
SATDMIALSGAHTIGQARCVNFRNRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDAST
PYAFDNFYYKNLLNKKGVLHSDQQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMGNIN
PITGSSGQIRKNCRKVN
NT seq 954 nt   +upstreamnt  +downstreamnt
atggcttcccctaaaccctttgcttgcagtgccattgccttgttatttgctgcaaacttg
gtgtcagctcagcttagcgcaaatttctatgacaaatcatgccctaatgcactgcccacc
atccgaatagccgtgagatctgccatcgcaagggagaaccgcatgggtgcatcattgctc
cgcctccacttccacgactgctttgtcaatggttgtgatggctcggtgctgctagatgac
actccaacattcactggagagaagaccgctgctccaaacaacaactctctgcgtggattt
gatgttatagacaacatcaaggcacatattgaggggatctgtccgcaggtggtctcatgt
gctgacatccttgctgtggcggcacgcgaatctgttgttgcgctaggaggtcctacttgg
gttgtccagctgggacggcgcgactcaacaacagcaagcctggatactgcaaacaatgac
attccagctccaacctttgaccttggtgatctcacgaagtctttttcaaacaaaggacta
agcgcaactgacatgattgcactctcaggggctcacaccataggccaggcaaggtgcgtc
aattttcgcaaccgcatctacagtgagaccaacatcgacacttccctggcaacatctctg
aaatcaaattgtccaaacacgactggcgacaacaacatatccccccttgatgcatcgacg
ccctacgcctttgacaatttttactacaagaacctgctgaacaagaagggtgtcctgcat
tctgaccagcaactattcaatggtggttcagcagattcccagacgaccacctactcatca
aacatggcaacattcttcactgatttcagcgcagcaatggtgaagatgggcaacatcaac
cccattactggatctagtggacagatcaggaagaactgcaggaaggtaaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275918
Entry
107275918         CDS       T01015                                 
Name
(RefSeq) peroxidase 1-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107275918
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107275918
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107275918
NCBI-ProteinID: XP_015646259
LinkDB
Position
7:20782945..20785121
AA seq 339 aa
MMAAIFVVLVAAAAAALVSSSAAQAQLKVGYYGDTCNGAEETVRQEVASVLSVAPYLAGA
LLRLHFHDCFVRGCDGSILLDSVAGGAVDAEKEAETSAGLRGFDVIDSIKEKLEQACPGT
VSCADILALAARDAVHWSNGPFWPVPTGRLDGKISNAAETVDLPPPNSGMAQLQAAFAHK
NLTAKDLVVLSGAHTIGFSHCQPFHDRLYNYTGGNRLNDVDPELDPAYLNELRSKCGAAA
SATANADNPGVMVEISPKRSPKFDTGYYTQVARRRGLFRSDAVLLDDDFTGAYVKKHATG
LFDMEFFGDFGEAMVNMGNLQPPPGNDGEVRRKCSVVNY
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgatggcagcaatctttgtcgtgttagtagcagcagcagcagcagctctcgtctcgtcc
agcgctgcgcaggcacagctcaaagttgggtattacggggacacatgcaacggcgcagaa
gagaccgtgaggcaggaggttgcatctgttctatccgtggcgccgtatctcgccggcgct
ctcctgaggctccatttccacgactgcttcgtcaggggatgcgacgggtcgatcctgttg
gactcggtggccggcggcgccgtcgacgccgagaaagaagctgaaacgagtgcaggcctg
agagggttcgacgtcatcgacagcatcaaggagaagctggagcaggcttgtcctgggact
gtttcgtgtgctgacatcctcgcccttgccgccagggacgctgttcattggagtaatggc
ccgttttggcctgtaccaactgggcggctcgatggaaaaatatcgaacgccgccgagacg
gttgatctcccgccaccaaattcaggcatggcacagctgcaagcagcgttcgcccataag
aacttgactgccaaggatctcgtcgtcctatcgggtgcgcacaccatcggcttctcgcac
tgccagccgttccacgaccgcctctacaactacaccggcgggaacaggctcaacgacgtc
gacccggagctcgacccggcctacctcaacgagctccggtccaagtgcggcgccgctgcc
agtgccactgccaacgccgacaacccgggggtcatggtggagatctcccccaagagatcg
cccaagttcgacacgggctactacacgcaggtcgcgcggcgccgcgggctgttccggtcc
gacgccgtgctgctcgacgacgacttcaccggagcctacgtcaagaagcacgcgacgggg
ctctttgacatggagttcttcggtgacttcggcgaggccatggtgaatatggggaacctc
cagccgccgccggggaatgatggcgaggtccggaggaagtgctccgtcgtcaattactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276369
Entry
107276369         CDS       T01015                                 
Name
(RefSeq) putative Peroxidase 48
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107276369
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107276369
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107276369
NCBI-ProteinID: XP_015621792
UniProt: Q5U1S5 A0A8J8Y7W0
LinkDB
Position
1:29610492..29612423
AA seq 366 aa
MRRPDPATGLRFAAVSLILCTANICAVARRSSYALLLDDEEDGGGGGDGSASFSFFPQTQ
PRGLVYGFYDESCPDAEGIVSSTVRELYLANPNVAAALVRLFFHDCFIHGCDASVLLDRI
NGDKSEREAAPNQSLRGFGAVDKIKARLEAACPRTVSCADILVLAARDSLVLAGGPSYPV
LTGRSDSARAFYDEVGARIPSPNATYTVTLDAFARRGFTERETVALLGAHSIGKVHCRFF
KDRIDNFAGTGEPDDTIDADMVEEMRAVCDGDGAAPMEMGYYRQGREVGFGAHYYAKLLG
GRGILRSDQQLTAGSTVRWVRVYAAGERGEEVFREDFAHAMVKLAALEPLTGSPGHVRIR
CSKPVE
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgacggcctgatccggcgactggcttgcgctttgcggccgtctcgctgatcctgtgc
acggccaacatctgtgcggtggccagacggtcgtcgtacgcgctcctgctcgacgacgag
gaggacggcggcggaggcggtgacggctcggcgtccttctccttcttcccgcagacgcag
ccgcgcgggctggtgtacgggttctacgacgagagttgccccgacgccgaggggatcgtg
tcgtccaccgtgcgggagctctacctcgccaaccccaacgtcgccgccgcgctcgtccgc
ctcttcttccacgactgcttcatccacggctgcgacgcctcggtgctcctggaccgcatc
aacggcgacaagtcggagagggaagcggccccgaaccagtcgctgagaggcttcggcgcc
gtcgacaagatcaaggcgaggctggaggcggcgtgcccgcggaccgtctcctgcgccgac
atcctggtcctcgccgcgcgggacagcctcgtcctagcgggcgggccgagctatcccgtg
ctcaccggacgcagcgacagcgccagggccttctacgacgaggtgggcgcgcgcatcccg
tcgccgaacgccacctacaccgtgacgctcgatgcgttcgcccgccgcggcttcaccgag
cgcgagaccgtcgcgctcttaggagcacatagcatcgggaaggtgcattgcagattcttc
aaggacaggatcgacaacttcgccgggacaggcgagcctgacgacaccatcgacgccgac
atggtcgaagagatgcgcgcggtgtgcgacggcgacggcgccgcgccgatggagatgggg
tactaccggcaggggagggaggtgggtttcggcgcgcactactacgcgaagcttctcggt
ggacggggcatcctgcggtcggaccagcagctcacggcggggagtaccgtgcggtgggtg
cgcgtgtacgcggccggggagcgcggcgaggaggtgttccgcgaggacttcgcgcacgca
atggttaagcttgccgcgcttgagccgctcaccgggtcgcccggccacgtccggatccgc
tgctccaaacccgtggagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276424
Entry
107276424         CDS       T01015                                 
Name
(RefSeq) peroxidase 5-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107276424
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107276424
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107276424
NCBI-ProteinID: XP_015647031
UniProt: Q69QL3 A0A0P0X2E1
LinkDB
Position
7:3061567..3063027
AA seq 321 aa
MFSRGMKLILMVAFQAMSLISISTASLQYNFYGSSCPNAEQTISNVVYGLIDADPSMAPA
LLRLHFHDCFVMGCDASILLDPTKANGSPEKTAIPLRGYDAVNKIKAAVEAVCPGKVSCA
DILAFAARDSVAKSGGFVYPVPAGSRDGNVSSAFSVFSSIPSPFFDAGELVQSFAAKGLT
VDDLVALSGAHSIGTAHCSGFKNRLYPTVDASLDASYAAALRAACPDGSAADDGVVNNSP
VSPATLGNQYFKNALAGRVLFTSDAALLTGQNDTAEKVRENAGDLTAWMARFAASMVKMG
GIEVLTGARGEVRRFCNVTNS
NT seq 966 nt   +upstreamnt  +downstreamnt
atgttcagcagggggatgaagctaattctcatggtagccttccaggctatgagcctcatc
tccatatcaactgcaagtctgcagtacaatttctacggctcgtcgtgcccaaatgccgag
cagacgatcagcaatgtcgtctacggcttgatcgatgctgacccttccatggccccggcg
ctgctgcgtttgcatttccatgattgctttgtcatgggttgtgatgcgtccatccttctt
gatcccacgaaggcaaacggctcgccggagaagacagcgatcccgctccgcgggtacgac
gccgtgaacaagatcaaggcggccgtcgaggccgtctgccccggcaaggtctcctgcgcc
gacatcctcgccttcgccgcccgcgactcggtggccaagtccggcggcttcgtctacccg
gtccccgccggcagccgcgacggcaacgtgtcgtccgccttctccgtcttctccagcatc
ccgtcgccgttcttcgacgccggggagctcgtccagagcttcgccgccaaggggctcacc
gtcgacgacctggtggcgctctcgggtgcgcactccatcggcaccgcgcactgctccggg
ttcaagaaccggctgtacccgacggtggacgcgtccctggacgcgagctacgcggcggcg
ctgagggcggcgtgccctgacggcagcgccgccgacgacggcgtggtgaacaacagcccc
gtgtcgccggcgacgctgggcaaccagtacttcaagaacgcgctcgccgggcgggtgctg
ttcacgtcggacgcggcgctgctgaccggccagaacgacacggcggagaaggtcagggag
aacgccggcgacctgaccgcgtggatggcgcggtttgcggcgtcgatggtgaagatgggc
ggcatcgaggtgctcaccggggcgcggggggaggtcaggaggttctgcaacgtcaccaac
agctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276425
Entry
107276425         CDS       T01015                                 
Name
(RefSeq) peroxidase 5-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107276425
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107276425
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107276425
NCBI-ProteinID: XP_015646217
UniProt: Q69QL3 A0A0P0X2E1
LinkDB
Position
7:3016323..3017783
AA seq 321 aa
MFSRGMKLILMVAFQAMSLISISTASLQYNFYGSSCPNAEQTISNVVYGLIDADPSMAPA
LLRLHFHDCFVMGCDASILLDPTKANGSPEKTAIPLRGYDAVNKIKAAVEAVCPGKVSCA
DILAFAARDSVAKSGGFVYPVPAGSRDGNVSSAFSVFSSIPSPFFDAGELVQSFAAKGLT
VDDLVALSGAHSIGTAHCSGFKNRLYPTVDASLDASYAAALRAACPDGSAADDGVVNNSP
VSPATLGNQYFKNALAGRVLFTSDAALLTGQNDTAEKVRENAGDLTAWMARFAASMVKMG
GIEVLTGARGEVRRFCNVTNS
NT seq 966 nt   +upstreamnt  +downstreamnt
atgttcagcagggggatgaagctaattctcatggtagccttccaggctatgagcctcatc
tccatatcaactgcaagtctgcagtacaatttctacggctcgtcgtgcccaaatgccgag
cagacgatcagcaatgtcgtctacggcttgatcgatgctgacccttccatggccccggcg
ctgctgcgtttgcatttccatgattgctttgtcatgggttgtgatgcgtccatccttctt
gatcccacgaaggcaaacggctcgccggagaagacagcgatcccgctccgcgggtacgac
gccgtgaacaagatcaaggcggccgtcgaggccgtctgccccggcaaggtctcctgcgcc
gacatcctcgccttcgccgcccgcgactcggtggccaagtccggcggcttcgtctacccg
gtccccgccggcagccgcgacggcaacgtgtcgtccgccttctccgtcttctccagcatc
ccgtcgccgttcttcgacgccggggagctcgtccagagcttcgccgccaaggggctcacc
gtcgacgacctggtggcgctctcgggtgcgcactccatcggcaccgcgcactgctccggg
ttcaagaaccggctgtacccgacggtggacgcgtccctggacgcgagctacgcggcggcg
ctgagggcggcgtgccctgacggcagcgccgccgacgacggcgtggtgaacaacagcccc
gtgtcgccggcgacgctgggcaaccagtacttcaagaacgcgctcgccgggcgggtgctg
ttcacgtcggacgcggcgctgctgaccggccagaacgacacggcggagaaggtcagggag
aacgccggcgacctgaccgcgtggatggcgcggtttgcggcgtcgatggtgaagatgggc
ggcatcgaggtgctcaccggggcgcggggggaggtcaggaggttctgcaacgtcaccaac
agctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276461
Entry
107276461         CDS       T01015                                 
Name
(RefSeq) peroxidase 2-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107276461
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107276461
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107276461
NCBI-ProteinID: XP_015646361
LinkDB
Position
7:3103412..3104351
AA seq 348 aa
MKLTVAIVCAMATALLAAAPSSAEAGDGELKVGYYDNKCSGIEDIVRSHVIKAISADRGI
GGSLIRLIFHDCFVRGCDGSVLLNASDENPRPETAAPVSIGLEGFDILEEIKADLERRCP
GVVSCADILIFAARDASSILSNGRVRFDVPAGRLDGVVSSAYEAQAELPDPTFTIRQLID
NFARKNFTVEELVVLSGAHSVGDGHCSSFTARLAAPPDQITPSYRNLLNYRCSRGGGADP
AVVNNARDEDLATVARFMPAFVGKLRPVSALDNTYYRNNLDKVVNFNSDWQLLTQDEARG
HVREYADNAALWDHDFAASLLKLSKLPMPVGSKGEIRNKCGAINHSKS
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaagctcacggtagcaattgtctgtgccatggcgaccgcgcttctcgccgccgccccg
tcgtcggcggaggccggcgacggcgagctgaaggtgggctactacgacaacaaatgcagc
ggcatcgaggacatcgtcaggtcgcacgtcatcaaggctatctcggcggaccgcggcata
ggcggctccctcatccgtctcatcttccatgattgttttgtcaggggttgcgatggttcc
gtcctccttaacgcgtccgacgagaaccctcgtcctgagacggcagcgccggtgagcatc
gggctggaaggattcgacatcctggaggagatcaaggccgatctcgagaggaggtgcccc
ggcgtggtctcctgcgccgacatcctcatcttcgccgcccgcgacgccagcagcatcctc
agcaacggccgcgtccgcttcgacgtccccgcgggccgcctcgacggcgtcgtctcctcc
gcctacgaggcccaggcggagctcccggatcccaccttcaccatccggcagctcatcgac
aacttcgcccgcaagaacttcaccgtcgaggagctcgtcgtcctctccggcgcgcactcc
gtcggcgacggccactgctcctccttcaccgcccgcctcgccgcgccgcccgaccagatc
accccgtcctaccgcaacctgctcaactacaggtgctcccgcggcggcggcgccgaccct
gcggtggtgaacaacgcccgcgacgaggacctcgccaccgtggcgaggttcatgccggcg
ttcgtcggcaagctgcggccggtcagcgccctggacaacacctactaccgcaacaacctc
gacaaggtggtcaacttcaactcggactggcagctgctgacgcaggacgaggcgcgcggc
cacgtccgcgagtacgccgacaacgccgccctctgggaccacgacttcgccgcctcgctg
ctcaagctcagcaagctgcccatgccggtggggagcaagggggagatcaggaacaagtgc
ggcgccatcaaccacagcaagagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278270
Entry
107278270         CDS       T01015                                 
Name
(RefSeq) peroxidase 2-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107278270
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107278270
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107278270
NCBI-ProteinID: XP_015647030
LinkDB
Position
7:3058578..3059599
AA seq 348 aa
MKLTVAIVCAMATALLAAAPSSAEAGDGELKVGYYDNKCSGIEDIVRSHVIKAISADRGI
GGSLIRLIFHDCFVRGCDGSVLLNASDENPRPETAAPVSIGLEGFDILEEIKADLERRCP
GVVSCADILIFAARDASSILSNGRVRFDVPAGRLDGVVSSAYEAQAELPDPTFTIRQLID
NFARKNFTVEELVVLSGAHSVGDGHCSSFTARLAAPPDQITPSYRNLLNYRCSRGGGADP
AVVNNARDEDLATVARFMPAFVGKLRPVSALDNTYYRNNLDKVVNFNSDWQLLTQDEARG
HVREYADNAALWDHDFAASLLKLSKLPMPVGSKGEIRNKCGAINHSKS
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaagctcacggtagcaattgtctgtgccatggcgaccgcgcttctcgccgccgccccg
tcgtcggcggaggccggcgacggcgagctgaaggtgggctactacgacaacaaatgcagc
ggcatcgaggacatcgtcaggtcgcacgtcatcaaggctatctcggcggaccgcggcata
ggcggctccctcatccgtctcatcttccatgattgttttgtcaggggttgcgatggttcc
gtcctccttaacgcgtccgacgagaaccctcgtcctgagacggcagcgccggtgagcatc
gggctggaaggattcgacatcctggaggagatcaaggccgatctcgagaggaggtgcccc
ggcgtggtctcctgcgccgacatcctcatcttcgccgcccgcgacgccagcagcatcctc
agcaacggccgcgtccgcttcgacgtccccgcgggccgcctcgacggcgtcgtctcctcc
gcctacgaggcccaggcggagctcccggatcccaccttcaccatccggcagctcatcgac
aacttcgcccgcaagaacttcaccgtcgaggagctcgtcgtcctctccggcgcgcactcc
gtcggcgacggccactgctcctccttcaccgcccgcctcgccgcgccgcccgaccagatc
accccgtcctaccgcaacctgctcaactacaggtgctcccgcggcggcggcgccgaccct
gcggtggtgaacaacgcccgcgacgaggacctcgccaccgtggcgaggttcatgccggcg
ttcgtcggcaagctgcggccggtcagcgccctggacaacacctactaccgcaacaacctc
gacaaggtggtcaacttcaactcggactggcagctgctgacgcaggacgaggcgcgcggc
cacgtccgcgagtacgccgacaacgccgccctctgggaccacgacttcgccgcctcgctg
ctcaagctcagcaagctgcccatgccggtggggagcaagggggagatcaggaacaagtgc
ggcgccatcaaccacagcaagagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278696
Entry
107278696         CDS       T01015                                 
Name
(RefSeq) peroxidase 70-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107278696
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107278696
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107278696
NCBI-ProteinID: XP_015641550
LinkDB
Position
6:complement(19265124..19266577)
AA seq 260 aa
HALQGCDASILLNATDSMESEKDAEPNATLAGFDVIDGIKSELERSCPATVSCADVLALA
ARDAVAMLSGPSWGVLLGRKDSLTASIDMANKDLPNPKDSLAELIRMFEKNGLDERDLTA
LSGAHTVGMAHDCKNYDDRIYSRVGQGGDSIDPSFAAQRRQECEQKHGNATAPFDERTPA
KFDNAYYIDLLARRGLLTSDQELYTQGCETGDLVKTYAMNGDVFFADFVRAMVKMGNIRP
KHWWTPAEVRLKCSVANTHY
NT seq 783 nt   +upstreamnt  +downstreamnt
catgcattgcagggttgtgatgcctccatccttctgaacgctacggactccatggagagc
gagaaggatgccgagcccaacgccaccctcgccggcttcgacgtgatcgacggcatcaag
tccgagctcgagcgcagctgcccggccaccgtctcctgcgccgatgttctcgcgctcgcc
gcccgcgacgccgtcgcgatgctcagcgggcccagctggggcgtgctcctcggccgcaag
gactccctcaccgccagcatagacatggccaacaaggatctcccgaacccgaaagacagc
ctggccgaactcatcaggatgttcgagaagaacggcctcgacgaacgcgacctcaccgcg
ctctccggtgcgcacaccgtcggcatggcacatgactgcaagaactacgacgaccgcatc
tacagccgcgtcggccagggcggcgacagcatcgacccatccttcgcggcgcaacgccgg
caggaatgcgagcagaagcacggcaacgccactgcgccgttcgacgagcggacgccggcc
aagttcgacaacgcctactacatcgacttgcttgcgaggcgcgggctcctcacatccgac
caggagctctacacccaggggtgcgagaccggcgacctggtgaagacgtacgccatgaac
ggcgacgtgttcttcgccgacttcgtgagggccatggttaagatggggaacatacgccca
aagcattggtggactccggcggaggtcaggctcaagtgctcggtggccaacacccattat
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278779
Entry
107278779         CDS       T01015                                 
Name
(RefSeq) peroxidase 44-like
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107278779
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107278779
SSDB
Motif
Pfam: peroxidase DUF1330
Other DBs
NCBI-GeneID: 107278779
NCBI-ProteinID: XP_015635198
UniProt: Q7X890
LinkDB
Position
4:complement(375212..377144)
AA seq 279 aa
MERRFYNDNTIAPAIIRMLFHDCFVTGCDASLLIVPTPTRPSPERVAIPNQTLRALNIVN
AVKSALEAACPGVVSCADALALMARDSFALLGGTAYDVALGRRDALHSNSWEDDLPAPFS
SLDDTLRHFAAKGFTADETVLLFGAHTVGAAHCSSFRYRLARPDDGTMDESLRCDMVGVC
GLADQPAAADYAMTFLDPVTPFAVDNAYYAQLMSNRSLLQVDQEAATHAATAGYVAYYAA
NPDAFLQRFSEVMAKLGTVGVLEGDAGEVRTVCTKYNTS
NT seq 840 nt   +upstreamnt  +downstreamnt
atggaacgccgcttctacaacgacaataccatcgcccccgccatcatccgcatgctcttc
cacgactgcttcgtcaccggttgcgacgcttctctgctcatcgtccccacgccgacgcgc
ccgtcgccggagcgggtggccatccccaaccagaccttgcgcgccttgaacatcgtcaac
gccgtcaagtccgccctcgaggccgcctgcccgggcgtcgtctcctgcgccgacgcgctc
gccctcatggcgcgggactccttcgccctcctcggcggcaccgcctacgacgtcgcgctc
ggccgccgcgacgccctccactccaactcctgggaggacgacctcccggcgcccttctcc
tccctcgacgacacgctccgccacttcgccgccaagggcttcaccgccgacgagaccgtc
ctcctcttcggcgcccacaccgtcggcgccgcgcactgctcctccttccgctaccgcctc
gccaggccggacgacggcaccatggacgagagcctccgctgcgacatggtcggcgtctgc
ggcctcgccgaccagccggcggcggccgactacgccatgaccttcctcgaccccgtcacg
cccttcgccgtcgacaacgcctactacgcgcagctcatgagcaacaggagcctcctgcag
gtggaccaggaggccgccacgcacgccgccacggcgggctacgtcgcctactacgcggcc
aaccccgacgccttcctgcagaggttctcggaggtgatggccaagctcgggacggtcggc
gtgctcgagggcgacgccggcgaggtcaggacagtctgcaccaagtacaacactagctag

DBGET integrated database retrieval system