KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275347
Entry
107275347         CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase 3, chloroplastic-like
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    107275347
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    107275347
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     107275347
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     107275347
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   107275347
SSDB
Motif
Pfam: IPPT IPT AAA_33 AAA_16 Zeta_toxin PPV_E1_C
Other DBs
NCBI-GeneID: 107275347
NCBI-ProteinID: XP_015630309
UniProt: Q10L50
LinkDB
Position
3:complement(13922595..13923768)
AA seq 328 aa
MEHCNGIAAVGRWLSTKPKVIFVLGATATGKSKLAIRLAARFDGEVINSDKIQAHDGFPV
ITNKVTDEERAGVAHHLLGGVSPDADFTAEDFRREAAAAVARVHAAGRLPVVAGGSNIYV
EALVAGGGGAFLAAYDCLFLWTDVAPDLLRWYTAARVDDMVRRGLVGEARAGFDAGADYT
RGVRRAIGLPEMHGYLLAEREGGAGAEDDDDLLAGMLEAAVREIKDNTFRLTVSQVAKIR
RLSALPGWDVRRVDATAVVARMAEGAPHGETWREVVWEPCEEMVSRFLETPAAAAAVVAN
GKVDVNVGDAAAGVPEAAAAAVVAAGVV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggagcactgcaatggcatcgccgccgttgggcgctggttgtccaccaagcccaaggtt
atcttcgtgctcggcgccaccgccaccggcaagtccaagctcgccatccgcctcgccgcg
cgcttcgacggcgaggtcatcaactccgacaagatccaggcgcacgacggcttcccggtc
atcaccaacaaggtcaccgacgaggagcgtgccggcgtcgcgcaccacctcctcggcggc
gtcagccccgacgccgacttcaccgcggaggacttccgccgcgaggcggccgccgccgtc
gcccgcgtccacgcggccggccgcctccccgtcgtcgccggcgggtcgaacatctacgtc
gaggcgctcgtggccggcggcggcggcgcgttcctcgcggcgtacgactgcctcttcctg
tggaccgacgtcgcgccggacctgctgcggtggtacacggcggcgcgcgtggacgacatg
gtgcggcgcgggctggtgggcgaggcccgcgccgggttcgacgccggggcggactacacc
cgcggcgtgcgccgcgccatcgggctacccgagatgcacggatacctgctggcggagcgc
gagggcggcgccggcgccgaggacgacgacgacctcctcgccggcatgctcgaggccgcc
gtgcgcgagatcaaggacaacacgttccgcctcaccgtgtcgcaggtggccaagatccgg
cgcctcagcgcgctgcccgggtgggacgtccggcgcgtggacgcgacggcggtggtggcg
cgcatggcggagggcgcgccccacggcgagacgtggagggaggtggtgtgggagccgtgc
gaggagatggtcagccgcttcctcgagacgcccgccgccgccgccgccgtcgttgccaac
ggcaaagtcgacgtgaacgtcggcgacgcggccgccggcgtgcctgaggctgccgccgcc
gccgtcgttgcggcgggtgtggtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275425
Entry
107275425         CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase 8, chloroplastic-like
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    107275425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    107275425
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     107275425
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     107275425
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   107275425
SSDB
Motif
Pfam: IPPT IPT AAA_33 PhoH AAA_5 AAA_28 TIP49 ResIII AAA_16 RNA_helicase AAA_19 AAA NACHT AAA_22 IstB_IS21
Other DBs
NCBI-GeneID: 107275425
NCBI-ProteinID: XP_015646476
UniProt: A0A0P0X3E8
LinkDB
Position
7:4833925..4834632
AA seq 235 aa
MLNFHPSCDCFLNMLGNKLVVIIGATGTGKTRLSIEIAKAIGGEVVNADKMQIYDGLDIT
TNKVSLQDRCGISHHLIASIPRNAGDFPVSFFRSAAKTTINCIARRGHTPIVVGGSNSLI
HGLLVDNFDSSIVDPFGQLEVSYRPTPRSQCCFLWVHVNEVILNEYLKHRVDDMVDAGLV
EEIEEYFDTLSVNGHVPYVGLGKTIGVPELSEYFTGRVSCSDALSMMKTNTQILA
NT seq 708 nt   +upstreamnt  +downstreamnt
atgctcaattttcacccttcttgtgattgcttcctcaatatgctgggaaacaagttagta
gtgattattggtgccacgggaactggaaaaacaagactctcaattgagatagccaaggcg
attggtggggaagtggtaaatgctgacaagatgcaaatttacgatggcctggatattacg
acaaacaaggtttctttacaagatcgatgcggcatatctcatcaccttattgcgtccatc
cctcgcaacgcaggtgattttcctgtgtcattttttcgatctgctgcaaaaaccacaata
aactgcattgccagacgtggtcacacaccgattgtggtgggtggatctaactcacttatc
catggtctccttgttgacaattttgattcgtctattgtggatccttttgggcaattggag
gttagctatcggccgacgcctcgatcgcaatgttgttttctatgggttcatgttaatgag
gtgattcttaatgagtatttgaaacatcgtgttgacgacatggttgatgctgggttagtt
gaggaaattgaagaatattttgacacattatcagttaatggacatgttccatatgtggga
ttagggaagaccattggtgttccagagctaagcgagtattttactggacgggtgagttgt
agtgatgctctttctatgatgaagaccaatacacagattcttgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276332
Entry
107276332         CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase 3, chloroplastic-like
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    107276332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    107276332
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     107276332
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     107276332
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   107276332
SSDB
Motif
Pfam: IPPT IPT AAA_25 PhoH AAA_33 IstB_IS21 AAA_22 AAA_7 AAA_16 ResIII DUF2075 AAA_28
Other DBs
NCBI-GeneID: 107276332
NCBI-ProteinID: XP_015646335
UniProt: Q6YWE1 A0A0P0X461
LinkDB
Position
7:6089818..6091454
AA seq 347 aa
MATSLSLAPKPAAVAVAAAAIPRLVPPPSIDMSALSPPPPLVSVSRSMVAKHKAVVVMGA
TGTGKTRLAVDLALQFGGEVINADKLQLHRGLDVATNKATADERAGVPHHLIGVAHPDEE
FTAADFRRAASRAAAAVAARGALPIIAGGSNSYIEELVDGDRRAFRDRYDCCFLWVDVQL
PVLHGFVGRRVDDMCGRGMVAEIEAAFDPDRTDYSRGVWRAIGVPELDAYLRSCAAAGGE
EERARLLANAIEDIKANTRWLSCRQRAKIVRLDRLWRIRRVDATEAFRRRGGAANEAWER
HVAAPSIDTVRSFLHGEFTTAAETTAAPVPPPPFLPMFALAAAGAGV
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggccacgtcactatccttggcgcccaaacccgccgccgtcgccgtcgccgccgccgcc
atcccgaggcttgttccgccgccgtctatcgacatgtcggcgctgtcgccgccgccgccg
ctcgtcagcgtcagcaggagcatggtagcgaagcacaaggccgtggttgtgatgggcgcg
acggggacggggaagacgcggctcgccgtcgacctcgcgctccagttcggcggcgaggtg
atcaacgccgacaagctgcagctgcaccgggggctcgacgtggccaccaacaaggccacc
gccgacgagcgcgccggcgtgccgcaccacctgatcggggtggcgcacccggacgaggag
ttcacggccgcggacttccgccgcgccgcgtcgcgcgccgccgccgcggtcgccgcgcgc
ggcgcgctgcccatcatcgccggcggctccaactcctacatcgaggagctcgtcgacggc
gaccgccgcgcgttccgcgaccggtacgactgctgcttcctgtgggtggacgtgcagctc
cccgtgctccacggcttcgtcggccgccgcgtcgacgacatgtgcggccgcgggatggtc
gccgagatcgaggcggcgttcgacccggaccgcaccgactactcccgcggcgtctggcgc
gccatcggcgtgccggagctcgacgcgtacctccgctcgtgcgccgccgccggcggcgag
gaggaacgcgcgcggctgctggccaatgccatcgaggacatcaaggcgaacacccgctgg
ctgtcgtgccggcagcgcgccaagatcgtgaggctagaccgcctatggcgaatccgccgc
gtggacgccacggaggcgttccggcggcgcggcggcgccgccaacgaggcgtgggagcgg
cacgtcgccgcgccgagcattgacaccgtgcgatccttcctccacggcgaattcaccacc
gccgccgaaactacggcggcgccggtgccgccaccgccgttcctccccatgtttgctctc
gccgcggcgggcgccggcgtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277295
Entry
107277295         CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase 3, chloroplastic-like
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    107277295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    107277295
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     107277295
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     107277295
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   107277295
SSDB
Motif
Pfam: IPPT IPT AAA_25 AAA_33
Other DBs
NCBI-GeneID: 107277295
NCBI-ProteinID: XP_015638866
UniProt: Q33CD8 A0A8J8Y6Z7
LinkDB
Position
5:complement(14261296..14262814)
AA seq 341 aa
MEGSRGDKGKVVVVMGATATGKSKLAIDLALRFGGEVINSDKIQVHDGLDVVTNKVTDEE
RAGVPHHLIGGVPPDADYGVDDFRRDAARAVASVLARGRVPVIAGGSNRYLEALLDGEGG
SFRERHELCFLWVDSRAPALHRYVRHRVDRMVEQGLVGEVRGLFRLDDADYSRGIRRSIG
VPEMDAYLRQEATGALLTHGDKYKVALLASAVGEIKANTWSLARRQLRKIHRLRGLPGWS
LRRLDVTRVLELKVEARSEAECAAAWEADVIAPAAREVGMFLHGGGNVVESGREEQPVVV
EKMEVAAVGGAGAAAAAEKWCGRRLLETTAAYHGMEAAAAV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaaggcagccgcggtgacaagggcaaggtagtggtggtgatgggcgccacggccacc
ggcaagtccaagctggccatcgacctcgcattgcggttcggcggcgaggtgatcaactcc
gacaagatccaggtgcacgacggcctcgacgtcgtcaccaacaaggtcaccgacgaggag
cgcgccggcgtgccgcaccacctcatcggcggggtgccccccgacgccgactacggcgtc
gacgacttccgccgcgacgccgcgcgcgccgtggcgtccgtcctcgccaggggccgcgtc
cccgtcatcgcgggcgggtcgaacaggtacctcgaagcgctgctcgacggcgagggtggg
tcgttccgcgagcggcacgagctgtgcttcctgtgggtggactcccgcgcgccggcgctg
cacaggtacgtgcgccaccgcgtggaccgcatggtggagcaggggctcgtcggcgaggtg
cgggggctgttccggctggacgacgccgactactcccgggggatccggaggtccatcggc
gtgccggagatggacgcctacctccggcaggaagccaccggcgccctactgacgcacgga
gacaagtacaaggtcgcgctgttggcttccgccgtcggcgagatcaaggcgaacacgtgg
agtctggcacgccgccagctgcggaagatccaccggctccgcggcctgcccggctggagc
ctccgccggctcgacgtcaccagagtgctggagttgaaggtggaggcccgcagcgaagcg
gagtgcgccgccgcgtgggaggcagacgtcatcgcgcctgcggcgcgggaggtggggatg
tttctgcatggaggagggaatgtggtggagagcggtagggaggagcagccggtggtggta
gagaagatggaggttgcggcagtgggtggtgccggtgcggcggcggccgcggagaagtgg
tgtggtcggcggttgctggagacgacggcggcgtaccatggaatggaggcggccgcggca
gtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278247
Entry
107278247         CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase-like
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    107278247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    107278247
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     107278247
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     107278247
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   107278247
SSDB
Motif
Pfam: IPPT IPT AAA_33 AAA_16 ResIII PhoH AAA_25 T2SSE AAA_22 AAA_29
Other DBs
NCBI-GeneID: 107278247
NCBI-ProteinID: XP_015646438
UniProt: T2HUN5
LinkDB
Position
1:28403240..28405106
AA seq 378 aa
MSSLGLKIRTVVRSPMAAAAVAGVGRDGSFASQKRPRRVSVRMERSRVGDGCCCSCSGRG
GVASTTAVRPSTGMVVIVGATGTGKTKLSIDAAQELAGEVVNADKIQLYDGLDVTTNKVS
LADRRGVPHHLLGAIRAEAGELPPSSFRSLAAAAAAGIASRGRVPVVAGGSNSLIHALLA
DPIDAAPRDPFADADVGYRPALRFPCCLLWVDVDDDVLDEYLDRRVDDMVGEGMVEELEE
YFATTSASERASHAGLGKAIGVPELGDYFAGRKSLDAAIDEIKANTRVLAARQVGKIRRM
ADVWGWPIRRLDATATIRARLSGAGRAAEAAAWERDVRGPGLAAMRQFVGRADFNAAAVD
QLAARSRRQCLRGGMVAG
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagcagtctcggtttgaagatccgcaccgtcgtccgctcacctatggcggccgcggcc
gtcgctggcgtcggaagggatggtagcttcgcctcccagaagcggccacgtcgggttagt
gtgagaatggagagaagcagagtcggggacggttgctgctgctcctgctctggccgcggc
ggggtggcgtccactacggcggtccggccgtccacggggatggtggtgatcgtcggcgcc
acgggcacggggaagaccaagctttccatcgacgcggcgcaggagctcgccggcgaggtg
gtgaacgctgacaagattcagctgtacgacggcctcgacgtcaccacgaacaaggtgtcg
ctcgccgaccgccggggcgtcccgcaccacctcctcggcgcaatccgcgccgaggccggg
gagctgccgccgtcgtcgttccgctcgctcgccgccgccgccgcggccggcatcgcgtcg
cgcgggcgcgtgccggtcgtggccggcgggtccaactcgctcatccacgcgctcctcgct
gaccccatcgatgccgcgccgcgtgaccctttcgcggacgccgatgtcgggtaccggccg
gcgctccggttcccgtgctgcctcctctgggtcgacgtcgacgacgatgttctcgacgaa
tacctcgaccggcgcgtggacgacatggtcggcgaggggatggtcgaggagctcgaggaa
tacttcgcgacgacgtcggcctcggagcgggcctcgcacgccgggctgggcaaggccatc
ggcgtgccggagctcggcgactacttcgccgggcgcaagagcctcgacgcggcgatagac
gagatcaaggccaacacgcgggtcctcgcggcccgccaggtcggcaagatccgacgcatg
gccgacgtttggggctggcccatccgccgcctcgacgccacggccaccatccgggcgcgg
ctctccggcgccggccgcgccgccgaggccgccgcgtgggagcgcgacgtgcgcgggcca
ggcctcgccgcgatgcgtcagttcgtcggccgcgccgacttcaacgccgcagcggtcgac
cagctagccgcgcggagtcggaggcaatgccttcgcggtggcatggtggccggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332870
Entry
4332870           CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase 3, chloroplastic
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    4332870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4332870
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     4332870
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     4332870
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   4332870
SSDB
Motif
Pfam: IPPT IPT AAA_33 Zeta_toxin AAA_16 PPV_E1_C
Other DBs
NCBI-GeneID: 4332870
NCBI-ProteinID: XP_015630300
UniProt: Q33CD9 Q0DRT3
LinkDB
Position
3:13796223..13799655
AA seq 325 aa
MEYHVGGVIGQSPKPKVVFVLGATATGKSKLAISIAERFGGEVINSDKIQVHDGFPIITN
KVTEEERAGVPHHLLGVLHPDADFTAEDFRREAAAAVARVLAAGRLPVVAGGSNTYVEAL
VEGGGGAFRAAHDCLFLWTDVAPGLLRWYTAARVDDMVRRGLVGEARAGFVDGAGAADYY
TRGVRRAIGIPEMHGYLLAERSGGEAADDGELAAMLDGAVREIKANTYRLAATQVAKIRR
LSALDGWDVRRVDATVVVARMAEGAPHRETWEAVVWKPCEEMVGRFLEASAAVDDDDNAA
AGSPAALAPMTAACRLRAQLVQLQY
NT seq 978 nt   +upstreamnt  +downstreamnt
atggagtaccacgtcggcggtgtcatcggacagtcacccaagcccaaggtcgtcttcgtg
ctcggcgccaccgccaccggcaagtccaagctcgccatctccatcgccgagcggttcggc
ggcgaggtgatcaactccgacaagatccaggtgcacgacgggttccccatcatcacgaac
aaggtcaccgaggaggagcgcgccggcgtcccccaccacctcctcggcgtcctccacccg
gacgccgacttcaccgccgaggacttccggcgcgaggcggccgccgccgtcgcccgcgtc
ctcgcggcgggccgcctccccgtcgtggccggcgggtcgaacacctacgtcgaggcgctg
gtggagggcggcggcggcgcgttccgcgcggcgcacgactgcctcttcctgtggaccgac
gtcgcgccgggcctgctgcggtggtacaccgcggcgcgcgtggacgacatggtgcggcgc
gggctggtgggcgaggcgcgcgccgggttcgtcgacggcgccggcgccgcggactactac
acccgcggcgtgcgccgcgccatcgggatcccggagatgcacgggtacctcctggccgag
cgctcgggcggcgaggcggccgacgacggcgagctcgccgccatgctcgacggcgccgtg
cgcgagatcaaggccaacacctaccgcctcgccgcgacgcaggtggcgaagatccggcgg
ctgagcgcgctggacgggtgggacgtgcggcgcgtggacgcgacggtggtggtggcgcgc
atggcggagggggcgccgcacagggagacgtgggaggcggtggtgtggaagccgtgcgag
gagatggtcggccgcttcctcgaggcgtccgccgccgtggatgacgatgacaatgccgcc
gccggttcgccggcggcgttggcaccgatgacggcggcgtgtcgcctgagggcgcagctg
gtgcagctgcaatactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334529
Entry
4334529           CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase 5, chloroplastic
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    4334529
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4334529
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     4334529
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     4334529
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   4334529
SSDB
Motif
Pfam: IPPT IPT AAA_33 AAA_25 PhoH AAA_16 AAA_22 DUF2075
Other DBs
NCBI-GeneID: 4334529
NCBI-ProteinID: XP_015632648
UniProt: A0A0P0W4L8 Q6ATR2
LinkDB
Position
3:33905814..33907590
AA seq 357 aa
MQAYMAVAAAPAPPASLTLLPRTTTVIRDRERFDAAVPVAPLVLRHGAGVKHKAVVVMGA
TGTGKSRLAVDLALRFGGEVINSDKMQIHSGLDVVTNKVTEEECAGVPHHLISVARPDDE
FTAADFRREAARAAAGAVERGRLPIIAGGSNSYVEELVEGDGRAFRERYECCFLWVDVDL
EVLRGFVARRVDEMCRRGLVREVAAAFDPRRTDYSRGIWRAIGVPELDAYLRSRGDGADE
EERARMLAAAVAEIKLNTFRLACRQHRKIERLDRMWRARRVDATEVFRRRGHAADDAWQR
LVAAPCIDAVRSFLFEDQERSSIAAGKPPLFAAGKATSGNISVFASAAAAMAAAAAI
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcaggcgtacatggcggtcgccgccgctccggcgccaccggcctcgctgacgctgctg
ccgcgcaccaccaccgtcatcagggacagggagcgcttcgacgcggccgtcccggtggcg
ccgctcgtgctgaggcatggcgccggcgtcaagcacaaggccgtcgtggtgatgggcgcc
acgggcaccgggaagtcacgcctcgccgtcgacctcgccctgcggttcggcggcgaggtc
atcaactccgataagatgcagatacattccgggttggatgtggtgacgaacaaggtgacc
gaggaggagtgcgccggcgtgccgcaccacctgatcagcgtggcgcgccccgacgacgag
ttcacggccgccgacttccgccgcgaggcggcgcgcgccgcggcgggggcggttgagagg
gggaggttgcccatcatcgccggggggtccaactcctacgtcgaggagctcgtcgaaggc
gacggccgcgcgttccgggagcggtacgagtgctgcttcctctgggtcgacgtagatctc
gaggtgctccgcggtttcgtcgcccgccgcgtcgacgagatgtgccggcgaggcctcgtc
cgggaggtggccgcagcgttcgacccgcgccgcaccgactactccaggggcatctggcgc
gccatcggcgtgccggagctcgacgcgtacctccgctcccgcggcgacggcgccgacgag
gaggagcgggcgcgcatgctcgccgcggccgtcgcggagatcaagttgaacacgttccgg
ctcgcgtgccgccagcaccgcaagatcgagaggctggaccgcatgtggcgcgcccgccgc
gtcgacgccacggaggtgttcaggaggcgcggccacgccgccgacgacgcgtggcagcgg
ctcgtcgccgcgccgtgcatcgacgccgtccggtcattcctcttcgaggaccaagaacgc
agcagcatcgccgccggcaaacctcccctcttcgccgccggcaaggccacttcaggcaac
atctccgtcttcgcctccgcggccgccgccatggcggcggccgctgcaatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339535
Entry
4339535           CDS       T01015                                 
Name
(RefSeq) adenylate isopentenyltransferase
  KO
K10760  adenylate dimethylallyltransferase (cytokinin synthase) [EC:2.5.1.27 2.5.1.112]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    4339535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4339535
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.27  adenylate dimethylallyltransferase (AMP-dependent)
     4339535
    2.5.1.112  adenylate dimethylallyltransferase (ADP/ATP-dependent)
     4339535
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Adenosine phosphate isopentenyltransferase
   4339535
SSDB
Motif
Pfam: IPPT IPT AAA_33 AAA_16 PhoH ResIII TniB
Other DBs
NCBI-GeneID: 4339535
NCBI-ProteinID: XP_015638462
UniProt: Q6L4G2 Q0DG59
LinkDB
Position
5:complement(27422988..27424789)
AA seq 360 aa
MTSVATRIATLVRAAAAASRPLRLHRRPGGEDTRMVVIVGATGTGKTKLSIDAAKVIGGE
VVNADKIQLYDGLDVTTNKVSLADRRGVPHHLLGAIRPEAGELPPSSFRSLAAATAASIA
ARRLVPVIAGGSNSLIHALLADHFDASAGDPFSPAAAFRHYRPALRFPCCLLWVHVDEAL
LDEYLDRRVDDMVDAGMVEELREYFATTTAAERAAHSGLGKAIGVPELGDYFAGRKTFSE
AIDDIKANTRVLAAAQVSKIRRMSDAWGWPIHRLDASDTVRARLTRAGSAAESASWERDV
RGPGLATIRSFLADQSPPPRSEGTNDYLYAMETEPEPPPPPTLPPRLLRLPRMQYCDMVG
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaccagcgttgccaccaggattgccacgctcgtgcgggccgcggcggcggcgagccgg
ccattgcggctccaccgccggcccggcggcgaggatacgaggatggtggtgatcgtcggc
gccacgggcaccgggaagaccaagctgtccatcgacgccgccaaggtgatcggcggcgag
gttgtcaacgccgacaagattcagctctatgacggcctcgacgtgaccaccaacaaggtg
agcctcgccgaccgccgtggcgtgccgcaccacctcctcggagccatccgccccgaggcc
ggcgagctcccgccgtcgtccttccggtccctcgccgccgccacggccgcgtcgatcgcg
gcgaggcggctcgtgccggtcatcgccggtgggtcgaactccctcatccacgccctcctc
gccgaccacttcgacgcctccgctggcgatcccttctcccccgccgccgccttccgccac
taccgcccggcgctccggttcccgtgctgcctgctctgggtccacgtcgatgaggcgctc
ctcgacgagtacctcgaccgccgcgtggacgacatggtggacgctggcatggtcgaggag
ctccgggagtacttcgccacgacaaccgccgcggagcgcgccgcgcactccgggctgggc
aaggccatcggcgtccccgagctcggcgactacttcgccgggcgcaagaccttctccgag
gcgatcgacgacatcaaagccaacacccgcgtcctcgccgccgcgcaggtgtccaagatc
cgccgcatgtccgacgcctggggctggcccatccaccgcctcgacgcctccgacacagtc
cgcgccaggctcacgcgggcgggctccgccgccgagtccgcctcctgggagcgcgacgtg
cgcggcccaggcctcgccaccatccgcagcttcctcgccgatcagtcaccgccaccgcgc
agcgagggcaccaacgactacctgtacgccatggagacggaaccagagccgccgccgccg
ccgacgttgccgccgcggctgctccggttgccgcggatgcagtactgcgacatggtgggg
tga

DBGET integrated database retrieval system