KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275366
Entry
107275366         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 11
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275366
   04120 Ubiquitin mediated proteolysis
    107275366
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275366
   04121 Ubiquitin system [BR:osa04121]
    107275366
   03036 Chromosome and associated proteins [BR:osa03036]
    107275366
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107275366
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107275366
   Cul7 complex
     107275366
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107275366
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107275366
SSDB
Motif
Pfam: Skp1 Skp1_POZ LZ3wCH BTB
Other DBs
NCBI-GeneID: 107275366
NCBI-ProteinID: XP_015645852
UniProt: Q69PW3
LinkDB
Position
7:2311481..2311912
AA seq 164 aa
MAAEKKEVADAAAGSGSDTILLISSDGEHFNVPSAAASLSQLVSNMIEDDCTTNGVPLPN
VASKVLAKVIEYCIKHAAAGEEEEKDLKSFDAEFIDVDKNMLYDLLLASNFMNIKSLLDL
CCQHTANLIKGKSPEQIRKEFGIKNDFTPEEEEEIRKENTWAFE
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcggcagagaagaaggaggttgccgacgccgccgccggcagcggcagcgacacaatc
ctcctaatcagctccgacggcgagcacttcaacgtgccgtcggcggcggcgagcctgtca
cagctcgtctccaacatgatcgaggacgactgcacgacgaacggggtgcctctccccaac
gtcgcctccaaggtcctcgccaaggtcatcgaatactgcatcaagcacgccgccgccggg
gaggaggaggagaaggatctgaagagcttcgacgccgagttcatcgatgtggacaagaac
atgctgtacgacctgctcctggcgtccaatttcatgaacatcaagagcttgctggatttg
tgctgccagcacacggcgaacctgatcaaaggcaagtcgccggagcagatcaggaaggag
tttgggatcaagaacgacttcacgccggaggaggaggaggaaatccgcaaggagaacaca
tgggccttcgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275430
Entry
107275430         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275430
   04120 Ubiquitin mediated proteolysis
    107275430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275430
   04121 Ubiquitin system [BR:osa04121]
    107275430
   03036 Chromosome and associated proteins [BR:osa03036]
    107275430
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107275430
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107275430
   Cul7 complex
     107275430
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107275430
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107275430
SSDB
Motif
Pfam: Skp1
Other DBs
NCBI-GeneID: 107275430
NCBI-ProteinID: XP_015624364
UniProt: A0A0P0VGP2 Q6Z8A9
LinkDB
Position
2:7024790..7025386
AA seq 198 aa
MAGKAAKATATNANNNGGGGYIRTVTLRGFDGIRVRVSAATMAAASATARARLDEAIRRT
PRHAAVPDDVLINVPGVARPVLARVADYCDRHYGGGGGGEGGEFAAPEGYGFDDPLARFD
DELMDGADVGTVVDLLRAAAFLRVERLADLASREVAACMRGRTVEGIRQVFGIANDYTDE
EEQDVRKENSWAFDAYND
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccggcaaagcggcgaaggcgacggcgactaatgctaacaacaacggcggcggcgga
tacataaggacggtgacgctgcgcggcttcgacggcatccgcgtccgcgtctcggcggcg
acgatggcggcggcgtcggcgacggcgagggccaggctcgacgaggcgatccggcggacg
ccccgccacgccgccgtccccgacgacgtcctcatcaacgtccccggcgtcgcccgcccc
gtgctcgcccgcgtcgccgactactgcgaccgccactacggcggcggcggcggcggcgag
ggcggcgagttcgcggcgccggaggggtacgggttcgacgacccgctggcgcggttcgac
gacgagctgatggacggcgccgacgtgggcacggtggtggacctcctccgcgccgccgcg
ttcctgcgggtggagcggctggccgacctggcgagccgcgaggtggcggcgtgcatgcgc
ggccggacggtggaggggatccgccaggtgttcggcatcgccaacgactacaccgacgag
gaagaacaggacgtccgcaaggagaattcttgggccttcgacgcctacaacgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275462
Entry
107275462         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 1B
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275462
   04120 Ubiquitin mediated proteolysis
    107275462
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275462
   04121 Ubiquitin system [BR:osa04121]
    107275462
   03036 Chromosome and associated proteins [BR:osa03036]
    107275462
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107275462
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107275462
   Cul7 complex
     107275462
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107275462
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107275462
SSDB
Motif
Pfam: Skp1 Skp1_POZ BTB LZ3wCH
Other DBs
NCBI-GeneID: 107275462
NCBI-ProteinID: XP_015646299
UniProt: A0A0P0X261 Q8H5C9
LinkDB
Position
7:complement(2285848..2286321)
AA seq 157 aa
MAADKKEVADDTILLISSDGEHFNVPSAAASLSQLVSNMIENDCTTNGVPLPNVASKVLA
KVIEYCVKHAAAAEDEEKELKSFDAEFMIDVDKNMLYGLLLASNFLNIKSLLDLCCQHTA
NLIKGKSPEQIRKEFGIKNDFTPEEEEIRKENTWAFE
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcggcagacaagaaggaggttgccgacgacacgatcctcttaatcagctccgacggc
gagcactttaacgtgccgtcggcggcggcgagcctgtcgcagctcgtctccaacatgatc
gagaacgactgcacgacgaacggggtgcctctccccaacgtcgcctccaaggtcctcgcc
aaggtcatcgaatactgcgtcaagcacgccgccgccgcggaggacgaggagaaggagctg
aagagcttcgacgccgagttcatgatcgacgtggacaagaacatgctgtacggcttgctc
ctggcgtccaatttcctgaacatcaagagcttgctggatttgtgctgccagcacacggcg
aacctgatcaaaggcaagtcgccggagcagatcaggaaggagtttgggatcaagaacgac
ttcacgccggaggaggaggaaatccgcaaggagaacacatgggcgttcgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275506
Entry
107275506         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275506
   04120 Ubiquitin mediated proteolysis
    107275506
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275506
   04121 Ubiquitin system [BR:osa04121]
    107275506
   03036 Chromosome and associated proteins [BR:osa03036]
    107275506
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107275506
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107275506
   Cul7 complex
     107275506
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107275506
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107275506
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 107275506
NCBI-ProteinID: XP_015611431
UniProt: Q6H4D6
LinkDB
Position
9:complement(5587864..5588526)
AA seq 165 aa
MAAVKEGADAGDSKILLISSDGQHFQVTEAEASMSKLVSNMIEDGCTENGVPLPNVASNV
LAKVLEYCKKHAAAAAAEDVAVKDQELKSFDASFIDVDNTMLFNLILAANYLNVPSLLDL
ACQHTADLIKGKTVQEIRDMFGIVNDFTPEEEEEIRKENEWAFEN
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggcagtaaaggagggagccgacgccggcgacagcaagatccttctgatcagctcg
gacgggcagcacttccaggtgacggaggcggaggcgagcatgtcgaagctagtgagcaac
atgatcgaggacggctgcacggagaacggcgtccctctccccaacgtcgcctccaacgtc
ctcgccaaggtgctcgagtactgcaagaaacacgccgccgccgccgctgccgaggacgtc
gccgtgaaggatcaggagctgaagagcttcgatgccagcttcatcgatgtcgacaacacg
atgctgttcaacttgatcttggccgccaactacttgaacgtgccgtctctacttgatctt
gcgtgccaacacacggctgacttgatcaagggcaagacggtacaggagatcagggacatg
ttcgggatcgtcaacgacttcacaccagaggaggaggaggagatccgcaaggagaacgaa
tgggccttcgagaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275529
Entry
107275529         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 11
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275529
   04120 Ubiquitin mediated proteolysis
    107275529
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275529
   04121 Ubiquitin system [BR:osa04121]
    107275529
   03036 Chromosome and associated proteins [BR:osa03036]
    107275529
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107275529
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107275529
   Cul7 complex
     107275529
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107275529
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107275529
SSDB
Motif
Pfam: Skp1_POZ Skp1 CobS_N
Other DBs
NCBI-GeneID: 107275529
NCBI-ProteinID: XP_015611090
UniProt: A3BWS2 Q6H4D4
LinkDB
Position
9:complement(5594786..5595304)
AA seq 172 aa
MAASAAAADGAADGEKMILLISSDGAKFELSEAAASLSKTLGNMIEDDCATNGAIPLANV
ASDILAKVVEYCNKHAAATATATAAAKASGEEELSKFDAEFVSVDRKKLFGLINAANFLN
MPCLLELTCQRAADLIKDMMPEQVREVFGIENDFTPEEEAEVRNENAWAYEM
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcagcatcggcagcagcagcagacggcgccgccgatggcgagaagatgatcctgctg
atcagctcggacggcgcgaaattcgagctgtcggaggcggcggcgagcctgtccaagacg
ttgggtaacatgatcgaggatgactgcgccaccaacggcgccatccctctcgccaacgtc
gcctccgatatcctcgccaaggtggtcgagtactgcaacaagcacgccgccgccaccgcc
acagccaccgccgccgcgaaagctagcggagaggaggagctcagtaagttcgacgccgag
ttcgtcagcgtcgacaggaagaagttgttcggcctgatcaatgccgccaacttcctgaac
atgccgtgcctgctggagctgacatgccagcgcgcggcggacttgatcaaagacatgatg
ccggagcaggtcagggaggtatttgggatcgagaacgacttcacgccggaggaggaggcc
gaggtccgtaacgagaacgcctgggcctatgagatgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275695
Entry
107275695         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275695
   04120 Ubiquitin mediated proteolysis
    107275695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275695
   04121 Ubiquitin system [BR:osa04121]
    107275695
   03036 Chromosome and associated proteins [BR:osa03036]
    107275695
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107275695
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107275695
   Cul7 complex
     107275695
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107275695
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107275695
SSDB
Motif
Pfam: Skp1_POZ Skp1 BTB
Other DBs
NCBI-GeneID: 107275695
NCBI-ProteinID: XP_015611187
UniProt: A0A0P0XN22
LinkDB
Position
9:complement(14628150..14628717)
AA seq 157 aa
AAAAAGDMILLISSDGQRFEVAQAVASMSRLVRNMVEDECTDNGVPLPNVPSAVLAKVLE
YCSEHAAAAAAAGEEVEELKSFDAAFIEVDNATLFDLILAANYLNVPCLLALACQRAADL
IRGKTVEEIRAEFNIANDFTPEEEAEIRKENAWAFQD
NT seq 474 nt   +upstreamnt  +downstreamnt
gccgccgccgccgccggcgacatgatcctgctgatcagctccgacggccagagattcgag
gtggcgcaggcggtggcgagcatgtcgaggctggtgcgcaacatggtcgaggacgagtgc
accgacaacggcgtccccctccccaacgtcccctccgccgtcctcgccaaggtgctcgag
tactgcagcgagcacgccgccgccgccgccgccgccggcgaggaggtggaggagctgaag
agcttcgacgcggcgttcatcgaagtggacaacgcgacgctgttcgacctgatcctggcc
gcgaactacctcaacgtgccgtgcctgctggccctcgcgtgccagcgcgcggccgacctg
atcagggggaagacggtggaggagatcagggccgagttcaacatcgccaacgacttcacg
cccgaggaggaggcggagatccgcaaggagaacgcgtgggccttccaggactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275970
Entry
107275970         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275970
   04120 Ubiquitin mediated proteolysis
    107275970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275970
   04121 Ubiquitin system [BR:osa04121]
    107275970
   03036 Chromosome and associated proteins [BR:osa03036]
    107275970
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107275970
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107275970
   Cul7 complex
     107275970
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107275970
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107275970
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 107275970
NCBI-ProteinID: XP_015649612
UniProt: A0A0N7KPR9
LinkDB
Position
8:17616260..17618811
AA seq 169 aa
MAATADNGEKMILLISSDGERFELSEAAASQSKTLSHMIEDDCTDNGVPLPNVTAVVLVK
VVEYFKKHAAVTPKPATEAVVADKAKREEELKSFDAEFVDVDRTMLFELILAANFLNAQD
LLDLTCQHAADLIKDMSVEEVREVFNITNDFTPEEEAEVRKENAWAFDN
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcggcgacagcggacaacggcgaaaagatgatcctcctgatcagctcggacggtgag
cgttttgagctgtcggaggcggcagcgagtcagtcaaagacattatcccacatgatcgag
gatgactgcaccgataatggggttcccctccccaacgtcaccgccgtcgtcctcgtcaag
gtggtcgagtacttcaagaaacacgccgccgtcacccccaagccagccacggaagccgtc
gttgctgataaagcgaagagggaggaggagctcaagagctttgacgccgagttcgtcgac
gtcgacaggacgatgttgttcgagttgattttggccgcaaacttcttgaacgcgcaggac
ctgctagatctgacctgccagcacgcggcggacttgatcaaagacatgtcggtggaggag
gtcagggaggtgttcaacatcaccaacgacttcacgccagaggaggaggcggaggtccgt
aaagagaacgcttgggcttttgacaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276398
Entry
107276398         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 11
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107276398
   04120 Ubiquitin mediated proteolysis
    107276398
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107276398
   04121 Ubiquitin system [BR:osa04121]
    107276398
   03036 Chromosome and associated proteins [BR:osa03036]
    107276398
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107276398
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107276398
   Cul7 complex
     107276398
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107276398
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107276398
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 107276398
NCBI-ProteinID: XP_015646058
UniProt: A0A8J8YQL3 A3BMD4
LinkDB
Position
7:25914583..25915489
AA seq 178 aa
MEGEDAVVPEAVAADAEKAEEKESGSRMITLKSNEGKAFVVTEVSARQSTTIGHMIDDDC
TREAVPLPNVDSKTLEKVIEYFDEHANNKADTDDEKAALDKFDKDFIGELDGDKAFLFHV
TMAANYLHAQGLLDLTTQCIADTIKGKTPEEIRTAFNIAYDLTEEDQEEIKEEDAWAF
NT seq 537 nt   +upstreamnt  +downstreamnt
atggagggagaggacgcggtggtgccggaggcggtggcggcggatgcggagaaggcggag
gagaaggagagcggcagcaggatgatcaccctgaagagcaacgagggcaaggcgttcgtt
gtgacggaggtgtcggcgaggcagtccacgaccatcgggcacatgatcgacgacgactgc
accagggaagccgtcccgctccccaacgtcgactctaagaccctcgagaaggtgatcgag
tacttcgacgagcacgccaacaacaaggccgacaccgacgacgagaaagcggcgctcgac
aagtttgacaaggacttcatcggcgagctggacggtgacaaggccttcctcttccacgtc
accatggccgccaactacctccacgcccaaggactcctcgacctcaccacccagtgcatc
gccgacaccatcaagggcaagacccccgaggagatccgcacggccttcaacatcgcgtac
gacctcaccgaggaggaccaggaggagatcaaggaggaggatgcctgggccttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277355
Entry
107277355         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 11
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107277355
   04120 Ubiquitin mediated proteolysis
    107277355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107277355
   04121 Ubiquitin system [BR:osa04121]
    107277355
   03036 Chromosome and associated proteins [BR:osa03036]
    107277355
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107277355
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107277355
   Cul7 complex
     107277355
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107277355
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107277355
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 107277355
NCBI-ProteinID: XP_015646221
UniProt: A0A0N7KNW1 Q8L561
LinkDB
Position
7:25884280..25885341
AA seq 200 aa
MAAGKGKGKEGECDMAAAAAEAEKKGEGSTVSRGAAGERVVEDSGGGRRTIHLKSKDGKQ
HDVTEASARLSKTIAGMILAGGGGGGADQCIPTPDIDHDTLRVVMQYCDKHAADDADEED
LKEWDEDFVDELDQDALFDVIAAANYLDIDGLLDLTCKRVADTIKGKTPEEIRKEFNIVN
DLSKEEEEEIRRENPWAFEQ
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcggcggggaaagggaaggggaaggagggagagtgcgacatggcggcggcggcggcg
gaggcggagaagaagggagagggctcgacggtgtcgcgcggagcggcgggggagcgggtg
gtggaggacagcggcggcggcaggaggacgatccacctcaagagcaaggatggcaagcag
catgatgtgacggaggcgtcggcgaggctgtccaagaccatcgccgggatgattctcgcc
ggcggcggcggcggcggcgccgaccagtgcatcccgacccccgacatcgaccacgatacc
ctccgcgtggtgatgcagtactgcgacaagcacgccgccgacgacgccgacgaggaggat
ctcaaggagtgggacgaagacttcgtcgacgagctggaccaggacgccctcttcgatgtc
atcgcggccgccaactacctcgacatcgatggcctcctcgacctcacctgcaagagggtc
gccgacacgatcaagggcaagacccccgaggagatccgcaaggagttcaacatcgtcaac
gacctcagtaaggaggaggaggaggagatccgccgggagaacccctgggccttcgagcag
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278210
Entry
107278210         CDS       T01015                                 
Name
(RefSeq) SKP1-like protein 13
  KO
K03094  S-phase kinase-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107278210
   04120 Ubiquitin mediated proteolysis
    107278210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107278210
   04121 Ubiquitin system [BR:osa04121]
    107278210
   03036 Chromosome and associated proteins [BR:osa03036]
    107278210
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107278210
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107278210
   Cul7 complex
     107278210
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107278210
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107278210
SSDB
Motif
Pfam: Skp1_POZ MTTB Ldi DUF932 EcsC SPOUT_MTase CTD7
Other DBs
NCBI-GeneID: 107278210
NCBI-ProteinID: XP_015646266
UniProt: A0A0P0X8X2
LinkDB
Position
7:25897824..25899143
AA seq 221 aa
MAEEKGKAVMPMEVDQVEDEREAETVVEAVQKAVYDALEKVEMMEEEGEAAVAEAADKLL
EEAVEKAVTEALEEAGWDAAEKALSDDLEKVSLEAESARMITLESSDGEVVKVKEASARL
SKTIGNIIDDGRGDEAIPLPDVSYKTLKKVVEYCDKHADEKSDTDEQKEELKNWDKAFID
ELAEDDDSLVKVIMASNYLKIDGLHNLASQCKTTREQIGKA
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcggaggagaaggggaaggcggtgatgccgatggaggtggatcaggtggaggacgag
agagaggccgagacggtggtggaggcggtgcagaaggcggtgtacgatgctttggagaag
gtggagatgatggaggaggagggagaggccgcggtggcggaggcggcggataagttgcta
gaggaggcggtggagaaggcggtgacggaggcgttggaggaggcggggtgggacgcggcg
gagaaggcgttgtccgatgatttggagaaggtctcgctggaggcggagagcgctaggatg
atcaccctcgagagctccgacggcgaggtggtcaaggtgaaggaggcgtcggcgaggctg
tccaagaccatcgggaacatcatcgatgacggccgcggcgacgaggccatcccgctcccg
gacgtcagctacaagaccctcaagaaggtggtcgagtactgcgacaagcacgccgacgag
aagtccgacaccgacgagcagaaagaggagctcaagaactgggacaaggccttcatcgac
gagctggccgaggacgacgactccctcgtcaaggtcatcatggcctccaactacctcaaa
atcgatggactccacaacctcgcctcccagtgcaagaccacccgcgagcagatcggcaag
gcctga

DBGET integrated database retrieval system