KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275378
Entry
107275378         CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC107275378
  KO
K07517  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107275378
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     107275378
SSDB
Motif
Pfam: ECH_1
Other DBs
NCBI-GeneID: 107275378
NCBI-ProteinID: XP_015616211
UniProt: A0A0P0Y1F7
LinkDB
Position
11:complement(9779649..9781012)
AA seq 232 aa
MSSFCTWTEQDGVYRLTLAGDDDHHYLTGETVDELTRTLAAIRERAMDQKPPAGAAARAL
ITASSAGSFCDGVDYERASPREKQAAADGMVAVIRELLAMPMLTVCAATGGARSLGLVLA
LAHDDVVVVSGGRYHLGMVERGVVVPPHVGALLRQKTDRWYTLGARVMAPRHDQGSYLKQ
WKVVDGVAGDRDGVLAEAERVAGAWNGDDGEAHAGMRRLLCRDSWEAVSGAQ
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtcttctttctgtacgtggacggagcaggatggcgtctaccgcctcacgctcgccggc
gacgacgaccaccactacctcaccggagagacagtcgacgagctcacccgcacgctcgcc
gccatccgcgagcgcgccatggatcagaagccgcccgccggcgccgctgcccgcgccctc
atcaccgcctcctccgcgggctccttctgcgacggcgtcgactacgagcgggcgagccca
agggagaagcaagccgccgccgacgggatggtcgccgtgatccgggagctcctggcgatg
ccgatgctgacggtgtgcgcggcgacgggcggcgcgcgctcgctgggcctggtgctggcg
ctggcgcacgacgacgtcgtggtggtgagcggggggcggtaccacctcgggatggtcgag
aggggcgtcgtcgtgccgccgcacgtcggcgcgctgctccggcagaagacggaccgctgg
tacacgctcggggcgcgggtgatggccccgaggcacgaccagggcagctacctcaagcaa
tggaaggtcgtggacggcgtggcgggagatcgcgacggcgtgctcgccgaggccgagagg
gtcgccggcgcatggaacggcgacgacggtgaagcacacgccggcatgaggaggctgctc
tgccgggattcgtgggaggccgtgagtggtgcccagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275410
Entry
107275410         CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC107275410
  KO
K07517  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107275410
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     107275410
SSDB
Other DBs
NCBI-GeneID: 107275410
NCBI-ProteinID: XP_015616212
UniProt: A3CAG2 Q53Q84
LinkDB
Position
11:complement(9788007..9788714)
AA seq 235 aa
MGFCTYKEKDDIFKLTLTGGNSGHNYLTEKSLKELKETLATIRGKATPSSRGLVTICSGK
SSFCDGIDYTSSPPPAVEELIRGMAEVVRELLGMPFPTVAAVGGDVRSSLALALVLAHDD
VAVLKKVKIEAREVVEGRHDAVPPYLGALLRDKSSYPQMSSDLVLRSETMAGERLKYWYL
IERVCDDQWELKGHAINMIKEVFGDERDGEAYVTTRKSLVFSESWKAVSELLKNI
NT seq 708 nt   +upstreamnt  +downstreamnt
atgggcttctgcacttacaaagagaaggatgacatcttcaagctgaccctcaccggcggc
aacagtggccacaattacctcaccgagaagtcgctgaaggagctcaaggagacgctcgcg
acgattcgcggcaaggccaccccctcgagcaggggcctcgttaccatctgctcgggcaag
agctccttctgcgacggcatcgactacacctcgtcgccgccgccggcggtggaggagctg
atccgcggcatggccgaggtggtgcgcgagctgctgggcatgcctttcccgacggtggcg
gccgtcggcggcgacgtgaggtcgtccctggcgctggcgctggtgctggcgcacgacgac
gtcgccgtgctaaagaaagtcaagatcgaggcgagggaggtggtggaggggcgccacgac
gccgtgccgccgtacctcggggcgctgctccgggacaagtcgtcgtacccgcagatgagc
tccgacctggtgctccggtcggagaccatggccggagagaggctcaagtattggtatctg
atcgagcgagtgtgcgacgaccagtgggagctgaagggccatgccattaacatgatcaaa
gaggtcttcggtgacgagcgcgacggcgaggcctacgtcaccacccgcaagagcttggtc
ttctccgagtcctggaaggccgtgtccgagttactcaagaacatctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327088
Entry
4327088           CDS       T01015                                 
Name
(RefSeq) enoyl-CoA delta isomerase 2, peroxisomal
  KO
K07517  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4327088
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     4327088
SSDB
Motif
Pfam: ECH_1 RnfC_N Ala_racemase_N
Other DBs
NCBI-GeneID: 4327088
NCBI-ProteinID: XP_015617787
UniProt: Q9LEA0 A0A0P0V033
LinkDB
Position
1:5773259..5774274
AA seq 247 aa
MDTASLCTVEKRGAVHVITLTGAGEHRLGPPLLSALRSAVAAVRAAAAAGAGGALVIAGE
GKYFSNGFDLDWARTVPAELHASMGGAFRGLVADLLALPVPTVAAVTGHAAAAGCALALA
HDAVVMRASRGFLYMSEVDAGLKIVDFFAELIRQKVPDAVNRRDLVLRGDKMTAADALRR
GIVDAAVDGGVDDVVAAAVREAEALAARGWDGEIVAETRKAIWPELWAKVKDHATDEPPP
PPPRPLL
NT seq 744 nt   +upstreamnt  +downstreamnt
atggacacggcgagcttgtgcaccgtggagaagcgcggcgccgtccacgtcatcaccctc
accggcgccggcgagcaccgcctcggcccgcccctcctgtccgcgctccgctccgccgtc
gccgccgtccgcgccgccgccgccgcgggcgccggcggcgcgctggtgattgccggcgag
ggcaagtacttctccaacgggttcgacctggactgggcgcgcaccgtgcccgccgagctg
cacgcctccatgggcggcgccttccggggcctcgtcgccgacctcctcgctctcccggtg
cccaccgtcgccgccgtcaccggccacgccgcggccgccgggtgcgcgctggcgctcgcg
cacgacgccgtggtcatgcgcgcctcccgcggcttcctgtacatgagcgaggtggacgcc
ggcctcaagatcgtcgacttcttcgccgagctgatccggcagaaggtccccgacgccgtg
aacaggagggatctagtcctccggggcgacaagatgacggcggccgacgccctgcggcgg
ggcatcgtggacgcggccgtcgacggcggcgtcgacgacgtggtggccgccgccgtccgg
gaggcggaggcgctcgcggcgaggggatgggacggggagatcgtggccgagaccaggaag
gcgatttggccggagctctgggccaaggtgaaggaccacgccaccgacgagcctccgccg
ccgccgccacggccgctgctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339402
Entry
4339402           CDS       T01015                                 
Name
(RefSeq) enoyl-CoA delta isomerase 3
  KO
K07517  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4339402
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     4339402
SSDB
Motif
Pfam: ECH_1 ECH_2 FTCD_N REF
Other DBs
NCBI-GeneID: 4339402
NCBI-ProteinID: XP_015639504
UniProt: Q65XC3 A0A0P0WQC5
LinkDB
Position
5:complement(26285503..26288432)
AA seq 242 aa
MCTLEQRGRVFVLTLTGDGEHRLGHSLIGSIRAAVSSVAAAAAAAGPGAALVTVAEGRFF
SNGLDIGPGGIPPSRVGELVVALRPLAADLLALPMPTVAAVTGHASAGGFLLTLCHDYRL
MRADRGVLYMSEIDIGLPLPPYFVAILRAKITAAHALRDVTLRGRKLKAAEAKEMGIVDV
VCPTAAETAAEAVKLAEQLAARKWNGNVYSSIRISMFPEACRSVGIVEESDEEKRNHFAS
KL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtgcacgctggagcagcgcggccgcgtgttcgtgctcacgctcaccggcgacggcgag
caccgcctcggccactccctcatcggctccatccgcgccgccgtctcatccgtcgcggcg
gcggcggcggcggccgggccgggcgcggcgctggtcaccgtggcggaggggcggttcttc
tccaacggactcgacatcggccctggcgggatccccccctcgcgggtcggggagctcgtc
gtggcgctccgccccctcgccgccgatctcctcgcgctccccatgcccaccgtcgccgcc
gtcacgggccacgcctccgcgggcgggttcctcctcacgctctgccacgactaccgcctc
atgcgcgccgaccgcggcgtgctctacatgagcgagatcgacatcggcctcccgctcccg
ccctacttcgtggccatcctccgcgccaagatcaccgccgcgcacgccctccgcgacgtc
accctccgcggcaggaagctcaaggccgcggaggccaaggagatgggaatcgtcgacgtg
gtttgccccaccgccgctgaaacggcggccgaggccgtcaagctcgccgagcagttggcg
gcgcggaagtggaacgggaacgtgtactcgtccattagaatatccatgttccctgaggct
tgcaggtccgtcggaattgtcgaggagagcgatgaggagaagaggaatcactttgcttct
aagctatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350260
Entry
4350260           CDS       T01015                                 
Name
(RefSeq) enoyl-CoA delta isomerase 2, peroxisomal
  KO
K07517  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4350260
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     4350260
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 4350260
NCBI-ProteinID: XP_015615970
UniProt: B7FAJ1
LinkDB
Position
11:complement(9407200..9409998)
AA seq 269 aa
MGFCTVQSPIDGIFVLTMASSDGHQYLTDEAIGDLIASLTAVRDTPGLRGLVTTSRLGSF
CDGVDHDAARQPDEQVAARVGEVVRLLLEMPAPTAAAVNGDATSLGLALALAHDHCVVWE
GAAVALPEARRRRPLPGYVAALLRDKVAYARLRKLLMLRAEACTGKELVGTWYSANDPAA
ADREVVAAEACELLEGIEVGSGKNYATARQAMWPESCAAVGMEITRPRRPSSPEQILHVS
EKEKEKHGASDQYQIKQTKIMKKIMYKTS
NT seq 810 nt   +upstreamnt  +downstreamnt
atgggtttctgcacggtgcaatccccaatcgatggcatcttcgtcctcaccatggccagc
agcgacggccaccagtatctcaccgacgaggccatcggggacctcatcgccagcctcacg
gccgtccgggacacgccggggctgagaggcctcgtcaccacctccaggctcggctccttc
tgcgacggcgtcgaccacgacgccgcccgacagccggacgaacaggtggcggcgcgcgtg
ggcgaggtggtccggctcctgctcgagatgccggcgcccaccgcggccgccgtgaacggc
gacgcgacgtcgctgggcctcgcgctggcgctggcgcacgaccactgcgtggtgtgggag
ggcgccgcggtggcgctcccggaggcccggcgccggcgcccactcccgggctacgtggcg
gcgctgctccgcgacaaggtcgcctacgcgcggctgcggaagctgctgatgctgagggcg
gaggcgtgcacggggaaggagctcgtcggcacgtggtactcggcgaacgaccccgccgcc
gccgacagggaggtggtggcggcggaggcttgcgagctgctcgaagggatcgaggtcggc
agcggcaagaactacgccacggcgaggcaggcgatgtggccggaaagctgcgccgccgtc
gggatggagatcacccggccacggcggccgtcgtctcctgagcaaattctccacgtcagt
gagaaggaaaaggagaaacatggggcatctgaccagtaccagattaagcagacgaaaatc
atgaagaagataatgtacaagaccagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266177
Entry
9266177           CDS       T01015                                 
Name
(RefSeq) enoyl-CoA delta isomerase 1, peroxisomal
  KO
K07517  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    9266177
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     9266177
SSDB
Motif
Pfam: ECH_1
Other DBs
NCBI-GeneID: 9266177
NCBI-ProteinID: XP_015616007
UniProt: B7FA43 C7J864
LinkDB
Position
11:complement(9410399..9411522)
AA seq 250 aa
MTMSSFCEWAKTDDGVFHLKLTGVDGHHYLTKEALHELRQKLAEIRELASSSPEPCRGLI
TSSSSSSSPSSPTTGSFCDGIDHKSLRANMAAPVAEQARVLADGMAAVVRELLAMPMPTV
CAATGGAASLGLALALAHDDLVVLSDAYYKLGNVEDGVAVPPHVAALVREKTDRWYTLTT
LKSRPRTGSWMRRWYFADGEAASRDGVVREAERLVGEWPAAGEDGKVHAETRRQLYRESW
EAVCAIVHDE
NT seq 753 nt   +upstreamnt  +downstreamnt
atgacaatgtcctccttctgtgagtgggcgaaaaccgacgacggcgtctttcacctgaag
ctcaccggagtcgatggccatcactacctaaccaaggaagctctccatgagctcaggcag
aagctcgcagagatccgcgagctcgcctcgtcgtcgccggagccatgccgaggcctcatc
acctcctcctcctcctcctcctcgccgtcgtcgccgacgacgggctccttctgcgacggc
atcgaccacaagagcctccgggccaacatggccgctccggtggccgagcaggccagggtc
ctcgccgacggcatggccgccgtggtgcgggagctcctcgccatgccgatgcccacagtg
tgcgcggccacggggggcgcggcgtcgctgggcctcgccctggcgctcgcgcacgacgac
ctcgtcgtcctcagcgacgcctactacaagctcggcaacgtcgaggacggcgtcgccgtg
ccaccgcacgtggcggcgctcgtccgggagaagaccgaccggtggtacacgctgacgacg
ctcaagtcgaggccgcgcacgggcagctggatgaggaggtggtacttcgccgacggcgag
gcggccagccgcgacggcgtggtgcgggaggcggagaggctcgtcggcgagtggccggcg
gctggcgaggacgggaaggtgcacgccgagacgcggaggcagctctaccgggagagctgg
gaggccgtgtgtgccattgttcatgacgaataa

DBGET integrated database retrieval system