KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275384
Entry
107275384         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein PRB1-3-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107275384
   04075 Plant hormone signal transduction
    107275384
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107275384
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107275384
NCBI-ProteinID: XP_015645839
UniProt: Q69P04 Q6YSG9
LinkDB
Position
7:1449143..1449874
AA seq 170 aa
MERSAEAKMMVVAMAAFAMIAMATTTTAQEFSANEKAVFVQLHNNARAAVGVGPVAWNDA
LAAQALQHARYCQTQHIPGPYGENLWWSYGAGTTGTPADAMSYWVGEKPYYDYSSNSCGG
RECRHYTQVVWRRTAYVGCARVACNTNNGIGTIIACNYYPGGNIYNERPY
NT seq 513 nt   +upstreamnt  +downstreamnt
atggagagatcagcagaagcaaagatgatggtggtggccatggcggctttcgccatgatt
gccatggccaccaccacgacggcccaagaattctcggcaaacgagaaggcggtcttcgtc
cagctccacaacaacgcccgggcggcggtgggcgtcgggccggtggcgtggaacgacgcg
ctggcggcgcaggccctgcagcacgcgcgctactgccagacgcagcacatcccggggccc
tacggcgagaacctgtggtggagctacggcgccggcaccaccgggacgccggccgacgcg
atgagctactgggtgggggagaagccgtactacgactacagcagcaacagctgcggcggc
cgcgagtgccgccactacacgcaggtggtgtggaggcgcacggcgtacgtcggctgcgcc
cgcgtcgcctgcaacaccaacaacggcatcggcaccatcatcgcttgcaactactacccg
ggtggcaacatatacaacgagaggccctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275413
Entry
107275413         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein 1-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107275413
   04075 Plant hormone signal transduction
    107275413
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107275413
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107275413
NCBI-ProteinID: XP_015645921
UniProt: A0A0P0X401
LinkDB
Position
7:complement(8009184..8009908)
AA seq 176 aa
MGSVPKKGAAFALAVAIATIVMATTTTMAADLSDAEKAQFVKLHNDARAAVGVKAQVSWS
EAVAAKAREHASTCRTDHIQGPYGENLWWGWSSTAGWVGKPADAMGSWVGEKPYYDRSSN
KCVGGKVCGHYTQVVWSRTTQIGCARVTGCNINGRSSTLIACNYNPRGNINGERPY
NT seq 531 nt   +upstreamnt  +downstreamnt
atgggaagtgtaccgaagaaaggagctgcctttgctctggcggtggccattgcgaccatc
gtgatggcgaccaccacgacgatggccgccgacctgtcggacgccgagaaggcacagttc
gtcaagctccacaacgacgcccgggccgcggtcggcgtcaaggcgcaggtgtcgtggagc
gaggcggtggcggcgaaggcccgggagcacgccagcacgtgccggacggaccacatacag
gggccctacggcgagaacctgtggtgggggtggagcagcaccgccggctgggtcgggaag
ccagcggacgcgatggggagctgggtgggcgagaagccgtactacgatcgcagcagcaac
aaatgcgtcggcgggaaggtgtgcggccactacacgcaggtggtgtggagccgcaccacc
cagatcggctgcgcgcgcgtcaccggctgcaacatcaacggtcgcagcagcacgctgatc
gcctgcaactacaacccgcgtggcaacattaacggggagcgcccctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275753
Entry
107275753         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein 1A-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107275753
   04075 Plant hormone signal transduction
    107275753
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107275753
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107275753
NCBI-ProteinID: XP_015646408
LinkDB
Position
7:1496823..1497348
AA seq 159 aa
MAATSAAGEDTAQDFVDLHNAVRDEVGVEEVTWDDTVAAYAESYAAQCQADCQPVSTNNG
TATYGENIYVVVGPAGGNDTSSSPAAAAVGAWAAEEQWYDPDTNGCSAPAGESCDHYTQL
VWNATTAIGCAEVVCDGDAGVFVICNYYPPGNIPDQSPY
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcagccacgtcggcggccggggaggacacggcgcaggacttcgtggacctgcacaac
gcggtgagggacgaagtcggcgtggaggaggtgacgtgggacgacaccgtggcggcgtac
gcggagtcctacgcggcgcagtgccaagccgactgccagcctgtaagcacgaacaacgga
acagccacctacggggagaacatctacgtagtcgtcggccccgccggcggcaacgacacg
tcgtcgtcgccggccgccgcggccgtgggcgcttgggcggcggaggagcagtggtacgac
cccgacaccaacggctgctcggcgccggcgggggagtcgtgcgaccactacacgcagctg
gtgtggaacgccaccacggccatcggctgcgccgaggtcgtctgcgacggcgacgccggc
gtcttcgtcatctgcaactactacccgccgggcaacatcccagaccagagcccctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276458
Entry
107276458         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein PRB1-3-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107276458
   04075 Plant hormone signal transduction
    107276458
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276458
SSDB
Motif
Pfam: CAP HTH_OrfB_IS605
Other DBs
NCBI-GeneID: 107276458
NCBI-ProteinID: XP_015646402
UniProt: A0A0P0X260
LinkDB
Position
7:1451850..1452591
AA seq 171 aa
MERSASAKMMVVVMAAFAMIIMATTTTAQQFSEDEKAAFVNLHNSARAAVGVGRVAWNDA
LAAQALQHARYCQTQHIPGPYGENLWWSYGAGTTGTPADAMSYWLAEKAKYYYDSNYCSA
GELGCTHYTQVVWRRTAYVGCARVACNTNGIGTIIACNYFPRGNMKNERPY
NT seq 516 nt   +upstreamnt  +downstreamnt
atggagagatcagcatcagcaaagatgatggtggtggtcatggcggctttcgccatgatt
atcatggccacgaccacgacggcgcaacaattctcggaagacgagaaggcggccttcgtc
aacctccacaacagcgcccgcgcggcggtgggcgtcgggcgggtggcgtggaacgacgcg
ctggcggcgcaggccctgcagcacgcgcgctactgccagacgcagcacatcccggggccc
tacggcgagaacctgtggtggagctacggcgccggcaccaccgggacgccggccgacgcc
atgagctactggctcgccgagaaggcaaagtactactacgacagcaactactgctcggcg
ggcgagctcggctgcacgcactacacgcaggtggtgtggaggcgcacggcgtacgtcggc
tgcgcccgcgtcgcctgcaataccaacggcatcggcaccatcatcgcttgcaactacttc
ccgcgtggtaacatgaagaacgaaaggccctactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276764
Entry
107276764         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein PRB1-3-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107276764
   04075 Plant hormone signal transduction
    107276764
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276764
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107276764
NCBI-ProteinID: XP_015642308
UniProt: Q69LU4
LinkDB
Position
6:14210266..14210920
AA seq 175 aa
MAISSVARAAIVILCLVALTNLAQAQNSPHDFLQPHNAARAEVGVGKLSWDGTLAAYARR
YGEKRSHDCTLKHSRGPYGENIYRGSAGRRRTAADAVARWVRESAYYDCGSNTCVPGRRC
GHYTQVTWARTTRLGCAAVTCDSGATFVVCSYDPPGNTNGRGPYPGCGDYDVVSE
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcgatcagtagtgttgcccgtgctgcaatagtaatcttgtgtctcgtcgccctcaca
aaccttgcgcaagcccagaactcgccgcacgacttcctgcaaccccacaacgccgcgcgc
gcggaggtcggtgtcggcaagctctcctgggacggcaccctcgccgcgtacgcgcggagg
tacggcgagaagaggtcccacgactgcacgctcaagcactcccgtgggccgtatggggag
aacatctaccggggcagcgccgggcggcggcggacggccgcggacgcggtggcgcggtgg
gtccgcgagagcgcctactacgactgcgggagcaacacctgcgtgccggggcggcgttgc
gggcactacacgcaggtcacgtgggcacggaccacgaggctcgggtgcgccgccgtgacg
tgcgatagcggcgccacgttcgtggtgtgtagctacgatccaccgggcaacaccaacggg
agaggtccgtaccctggatgtggggattatgatgtcgtgtccgaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277170
Entry
107277170         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein PRB1-2-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107277170
   04075 Plant hormone signal transduction
    107277170
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107277170
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107277170
NCBI-ProteinID: XP_015645339
UniProt: Q84J99 C7J4M6
LinkDB
Position
7:1401633..1402361
AA seq 172 aa
MASKAFALVLLAAATLAMAASTAAAQSSPQDFVDAHNDARRGEGVGLPDVVWNTTLQAFA
ESYVAVLAATCSLDHSNSVQLGYGENLYMGGAGSASTAADAVGLWMEEKADYVYSSNTCT
RGALLDCGHYTQVVWRSTTSIGCARAACSNGGGVIISCNYFPPGNFPDQRPY
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcgtcgaaagcctttgcactcgtgctgctggcggcggcgacgctggccatggcggcc
agcacggcggcggcgcagagctcgccgcaggacttcgtcgacgcccacaacgacgcccgc
cgcggcgagggcgtcggcctccccgacgtggtgtggaacacgacgctgcaggcgttcgcg
gagagctacgtggcggtgctcgccgccacctgcagcctcgaccactcgaacagcgtgcag
ctgggctacggcgagaacctgtacatgggcggcgccggcagcgcgtcgacggcggcggac
gcggtcggcttgtggatggaggagaaggcggactacgtgtacagcagcaacacgtgcacg
aggggggcgctgctcgactgcggccactacacgcaggtggtgtggcggagcacgacgtcg
atcggctgcgcgcgcgccgcctgcagcaacggcggcggtgtcatcatcagctgcaactat
ttcccgcccggcaacttccccgatcagcgcccttactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277171
Entry
107277171         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein PRB1-2-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107277171
   04075 Plant hormone signal transduction
    107277171
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107277171
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107277171
NCBI-ProteinID: XP_015645346
UniProt: Q84J99 C7J4M6
LinkDB
Position
7:1368483..1369211
AA seq 172 aa
MASKAFALVLLAAATLAMAASTAAAQSSPQDFVDAHNDARRGEGVGLPDVVWNTTLQAFA
ESYVAVLAATCSLDHSNSVQLGYGENLYMGGAGSASTAADAVGLWMEEKADYVYSSNTCT
RGALLDCGHYTQVVWRSTTSIGCARAACSNGGGVIISCNYFPPGNFPDQRPY
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcgtcgaaagcctttgcactcgtgctgctggcggcggcgacgctggccatggcggcc
agcacggcggcggcgcagagctcgccgcaggacttcgtcgacgcccacaacgacgcccgc
cgcggcgagggcgtcggcctccccgacgtggtgtggaacacgacgctgcaggcgttcgcg
gagagctacgtggcggtgctcgccgccacctgcagcctcgaccactcgaacagcgtgcag
ctgggctacggcgagaacctgtacatgggcggcgccggcagcgcgtcgacggcggcggac
gcggtcggcttgtggatggaggagaaggcggactacgtgtacagcagcaacacgtgcacg
aggggggcgctgctcgactgcggccactacacgcaggtggtgtggcggagcacgacgtcg
atcggctgcgcgcgcgccgcctgcagcaacggcggcggtgtcatcatcagctgcaactat
ttcccgcccggcaacttccccgatcagcgcccttactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277316
Entry
107277316         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein 1-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107277316
   04075 Plant hormone signal transduction
    107277316
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107277316
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107277316
NCBI-ProteinID: XP_015644669
UniProt: Q84J76 Q0D8V1
LinkDB
Position
7:1385325..1386103
AA seq 179 aa
METPKISGVALAAAIAVVLAMATTPAVAQNSPQDFVDLHNAARRVEGVGEVVWDDAVAAY
AENYAAERAGDCALIHSGSWEKAGYGENLFGGSGSEWTAADAVNSWVGEKDLYDYDSNSC
LGSWDSCLHYTQVMWSRTTAIGCARVDCDNGGVFITCNYNPAGNFQGERPFERGLTLSA
NT seq 540 nt   +upstreamnt  +downstreamnt
atggagacaccaaagatatcgggagtagcacttgcggcagccattgccgtcgttctggcc
atggcgaccacgccggcggtggcgcagaactcgccgcaggacttcgtggacctccacaac
gcggcgcgacgcgtggagggcgtcggcgaggtggtctgggacgacgccgtggcggcgtac
gcggagaactacgcggcggagcgcgccggcgactgcgcgctcatccactccggcagctgg
gagaaggccggctacggcgagaacctcttcggaggctccggcagcgagtggacggcagcg
gacgccgtcaacagctgggtgggggagaaggatctgtacgactacgacagcaacagctgc
ctggggtcgtgggactcgtgcctccactacacgcaggtgatgtggagccgcacgacggcg
atcggctgcgcccgcgtggactgcgacaacggcggcgtcttcatcacctgcaactacaac
cccgccggcaacttccagggagagcgccccttcgagcgtggcctcactctctctgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278128
Entry
107278128         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein PRB1-3-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107278128
   04075 Plant hormone signal transduction
    107278128
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107278128
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107278128
NCBI-ProteinID: XP_015645609
UniProt: Q7EYQ2 Q6YSH2
LinkDB
Position
7:complement(1355340..1356292)
AA seq 169 aa
MERGASFAVVMAAMAVVLATTSTAQAQTTATDIVNIHNAARSAVGVPALSWDDNLAAYAQ
GYANQRAGDCALRHSDRNNYQYGENLSWNPSVQAWTAASSVDQWVAEKGSYDYASNSCVG
GAMCGHYTQVVWRDTTAVGCAAVACNANRGVFFICTYFPAGNVQNQRPY
NT seq 510 nt   +upstreamnt  +downstreamnt
atggagagaggagcgagctttgcagtggtgatggcggccatggcggtggttctggccacc
acatcgacggcgcaggcccagaccacggcgaccgacatcgtcaacatccacaacgccgcc
cggagcgccgtcggcgtcccggcgctgtcgtgggacgacaacctggcggcgtacgcgcag
ggctacgcgaaccagcgcgccggcgactgcgcgctgcggcactccgatcgcaacaactat
cagtacggcgagaacctgtcgtggaacccctccgtgcaggcgtggacggcggcgagctcc
gtcgaccagtgggtggcggagaagggctcctacgactacgccagcaacagctgcgtcggc
ggcgccatgtgcggccactacacgcaggtcgtgtggcgcgacaccaccgccgtcggatgc
gccgccgtcgcctgcaacgccaaccgaggcgtcttcttcatctgcacctacttccccgcc
ggcaacgtccaaaaccagaggccgtactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278129
Entry
107278129         CDS       T01015                                 
Name
(RefSeq) pathogenesis-related protein PRB1-3-like
  KO
K13449  pathogenesis-related protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107278129
   04075 Plant hormone signal transduction
    107278129
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107278129
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 107278129
NCBI-ProteinID: XP_015645604
UniProt: Q7EYQ2 Q6YSH2
LinkDB
Position
7:complement(1388493..1389447)
AA seq 169 aa
MERGASFAVVMAAMAVVLATTSTAQAQTTATDIVNIHNAARSAVGVPALSWDDNLAAYAQ
GYANQRAGDCALRHSDRNNYQYGENLSWNPSVQAWTAASSVDQWVAEKGSYDYASNSCVG
GAMCGHYTQVVWRDTTAVGCAAVACNANRGVFFICTYFPAGNVQNQRPY
NT seq 510 nt   +upstreamnt  +downstreamnt
atggagagaggagcgagctttgcagtggtgatggcggccatggcggtggttctggccacc
acatcgacggcgcaggcccagaccacggcgaccgacatcgtcaacatccacaacgccgcc
cggagcgccgtcggcgtcccggcgctgtcgtgggacgacaacctggcggcgtacgcgcag
ggctacgcgaaccagcgcgccggcgactgcgcgctgcggcactccgatcgcaacaactat
cagtacggcgagaacctgtcgtggaacccctccgtgcaggcgtggacggcggcgagctcc
gtcgaccagtgggtggcggagaagggctcctacgactacgccagcaacagctgcgtcggc
ggcgccatgtgcggccactacacgcaggtcgtgtggcgcgacaccaccgccgtcggatgc
gccgccgtcgcctgcaacgccaaccgaggcgtcttcttcatctgcacctacttccccgcc
ggcaacgtccaaaaccagaggccgtactag

DBGET integrated database retrieval system