KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275423
Entry
107275423         CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P2A-like
  KO
K02943  large subunit ribosomal protein LP2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107275423
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107275423
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107275423
SSDB
Motif
Pfam: Ribosomal_60s Cytomega_UL84 OCC1
Other DBs
NCBI-GeneID: 107275423
NCBI-ProteinID: XP_015649690
UniProt: A3BR69 A0A8J8XE07
LinkDB
Position
8:complement(9181121..9181597)
AA seq 114 aa
MRFVSAYLMAYIGGNESPSKDDVRAILGSVGADVDEAKLDLLFEEIAGKDIPELIAAGRE
RLALAAPCGGVAAAAAGGQAVAAGGAAAAAEEEAEEEEKKKEEEDDDGLFNLFD
NT seq 345 nt   +upstreamnt  +downstreamnt
atgaggttcgtgtcggcgtacctgatggcctacatcggcggcaacgagagcccgagcaag
gacgacgtgcgcgccatcctcggctccgtcggcgccgacgtcgacgaggccaagctcgac
ctcctcttcgaggagatcgccggcaaggacatccccgagctcatcgcagccgggagggag
aggctcgcgctcgcggcgccctgcggaggcgtcgccgctgctgcggcgggtggtcaggcc
gtcgctgctggcggcgccgccgccgccgcggaggaggaggctgaggaggaggagaagaag
aaggaggaggaggacgacgacggcttgtttaacctcttcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276117
Entry
107276117         CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P2A-like
  KO
K02943  large subunit ribosomal protein LP2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107276117
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107276117
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107276117
SSDB
Motif
Pfam: Ribosomal_60s DNA_pol3_gamma3 DUF3824
Other DBs
NCBI-GeneID: 107276117
NCBI-ProteinID: XP_015645635
UniProt: A3BJK9 A0A8J8XDJ8
LinkDB
Position
7:16810282..16811348
AA seq 109 aa
MRFVAAYLMATIGGNASPTKDDVRAILGAVGADIDEDKLGYLFDQVAGKDLAEILAAGSE
MLAFGAAPAAAAATAGGAAAAGEKEEEEKVEEKEKEGEDDIVFSLFDDE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaggttcgtggcggcgtacctgatggcgaccattggcggcaacgcgagcccgaccaag
gacgacgtgcgcgccatcctcggcgccgtcggcgccgacatcgacgaggacaagctcggc
tacctcttcgaccaggtcgccggcaaggacctcgccgagatcttggccgccggaagcgag
atgctcgccttcggcgccgctccggccgccgccgccgccactgccggtggcgccgcggca
gctggggagaaggaggaggaggagaaggttgaggagaaggagaaggagggggaggacgac
atcgtcttcagcctcttcgacgacgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325892
Entry
4325892           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P3-like
  KO
K02942  large subunit ribosomal protein LP1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325892
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4325892
SSDB
Motif
Pfam: Ribosomal_60s
Other DBs
NCBI-GeneID: 4325892
NCBI-ProteinID: XP_015618339
UniProt: Q5NB69 B9EUI4
LinkDB
Position
1:complement(7278782..7280261)
AA seq 119 aa
MGVYTFVCRSSGEEWTAKQLKGELEASAATPYELQRRLVAAASAADSAAGVQSSFAMVSP
SSAVFQVIIGAVGGGAAIGGAAAGGAAAGGAAAEAPKAEEKKEEEKEESEDDLGFSLFD
NT seq 360 nt   +upstreamnt  +downstreamnt
atgggcgtctacaccttcgtgtgccggagctccggcgaggagtggacggccaagcagctc
aagggcgagctcgaggcctccgccgccaccccctacgagctgcagcgccgcctcgtcgcc
gccgcgtccgccgccgactcggccgccggggtccagtcctccttcgccatggtctccccc
agctccgccgtcttccaggtgatcatcggtgctgttggtggtggtgctgccattggaggt
gctgctgctggcggtgccgctgctggtggagctgccgccgaggcccccaaagccgaggag
aagaaggaagaggagaaggaagaaagtgaagacgaccttggattctccctctttgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326782
Entry
4326782           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P2A
  KO
K02943  large subunit ribosomal protein LP2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326782
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4326782
SSDB
Motif
Pfam: Ribosomal_60s Apolipo_F
Other DBs
NCBI-GeneID: 4326782
NCBI-ProteinID: XP_015622106
UniProt: A0A0P0UZY4 Q5SNH7
LinkDB
Position
1:4852384..4854389
AA seq 114 aa
MKFISAYLMAYLAGNSSPTAEDLTTILESVGCEIDNAKMELLLSQVSGKDITELIACGRE
KFASVPSGGGGVAVAAAAPAAGGAGGAPAAEAKKEDKVEEKEESDDDMGFSLFD
NT seq 345 nt   +upstreamnt  +downstreamnt
atgaagttcatttctgcctatctgatggcctatctggctggcaactccagccccactgcg
gaggatttgacaacgattctggagtcagttggttgtgaaatcgacaatgcaaagatggaa
ctcctgttgtctcaagtgagtggcaaggacatcactgagctcatcgcttgtggcagggag
aagtttgcttcagttccatctggtggtggtggtgtagctgttgctgctgctgctcctgct
gccggtggtgctggtggtgctcctgcagctgaggcgaagaaagaagataaggtcgaagag
aaggaagaaagtgatgatgacatgggcttcagtttgtttgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329540
Entry
4329540           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P2A
  KO
K02943  large subunit ribosomal protein LP2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329540
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4329540
SSDB
Motif
Pfam: Ribosomal_60s
Other DBs
NCBI-GeneID: 4329540
NCBI-ProteinID: XP_015623698
UniProt: A3A7K4 Q6H764
LinkDB
Position
2:complement(19455152..19458401)
AA seq 113 aa
MKFISAYLLATLAGNPNPSAEDLTTILESVGAEVDHGKMELLLSQLAGKDITEIIASGRE
KFASVPCGGGGVAVAAAAPAAGGGAAPQSEAKKEEKVEEKEESDDDMGFSLFD
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaagttcatttctgcctatctccttgccactcttgctggtaaccctaacccatctgcg
gaggatcttacaactattctggagtcagttggagctgaagttgaccatggcaagatggag
ttactcttgtctcaactggctggtaaggatatcactgagattattgcttccggtcgggag
aagtttgcttctgttccatgtggcggaggtggcgtagctgttgcagcagctgctccggct
gctggtggtggagctgctcctcaatctgaggctaagaaagaagagaaggtggaggagaaa
gaagaatctgatgatgacatgggcttcagtttgtttgactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338938
Entry
4338938           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P2B
  KO
K02943  large subunit ribosomal protein LP2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338938
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4338938
SSDB
Motif
Pfam: Ribosomal_60s
Other DBs
NCBI-GeneID: 4338938
NCBI-ProteinID: XP_015640657
UniProt: B7F7A3 Q65WT5
LinkDB
Position
5:21835371..21837578
AA seq 113 aa
MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDITEVIAAGRE
KFASVPSGGGGGIAVAAPTAAGGGAAPAEEAKKEEKVEEKEESDDDMGFSLFD
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaagctgatcgctgcctacctgctcgctgttctgggtggaaacacctctccatctgct
gatgacattaagaacattctggaatcagttggcgttgaagctaatgacgagaggctggag
ttcctgctctcagaactggagggcaaggacataacagaagtgattgctgctggaagggag
aagtttgcttctgtgccctcaggtggtggtggtggcatagctgtggcagctcctacagct
gcaggtggcggtgcagcacctgctgaagaggcaaagaaagaggagaaggtcgaagagaag
gaagagtctgatgatgacatgggtttcagcttgtttgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341969
Entry
4341969           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P3
  KO
K02942  large subunit ribosomal protein LP1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4341969
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4341969
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4341969
SSDB
Motif
Pfam: Ribosomal_60s
Other DBs
NCBI-GeneID: 4341969
NCBI-ProteinID: XP_015641043
UniProt: P56724
LinkDB
Position
6:complement(29527387..29528967)
AA seq 119 aa
MGVYTFVCRSSGDEWTAKQLKGELEASAATPYELQRRLVAAASAADSAAGVQSSFSMVSP
SSAVFQVIIGAVGGGAAIGGGAAAGAASGGAAAEAPKAEEKKEEEKEESEDDLGFSLFD
NT seq 360 nt   +upstreamnt  +downstreamnt
atgggcgtgtacaccttcgtgtgccggagctccggcgacgagtggacggccaagcagctc
aagggcgagctggaggcctccgccgccaccccctacgagctgcagcgccgcctcgtcgcc
gccgcgtccgccgccgactcggccgccggagtccagtcctccttctccatggtctcgccc
agctccgccgtcttccaggtgatcattggtgccgttggtggtggtgccgcgattggtgga
ggtgctgctgctggtgccgcctccggtggagctgctgccgaggcccccaaggccgaggag
aagaaggaagaagagaaggaggaaagcgaggacgacctcggattctccctcttcgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344516
Entry
4344516           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P1
  KO
K02942  large subunit ribosomal protein LP1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344516
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4344516
SSDB
Motif
Pfam: Ribosomal_60s
Other DBs
NCBI-GeneID: 4344516
NCBI-ProteinID: XP_015650060
UniProt: Q69UI8 A3BP24
LinkDB
Position
8:904056..905662
AA seq 110 aa
MSSSEVACTLAALILHDDGIPITSEKIATLVKAANIKVEAYWPGLFAKLLEHRSVDDLIL
SVGSGGGAAPVAAAAAPAAGGGAAAAPAAEEKKEEAKEESDDDMGFSLFD
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtcgtccagcgaggtcgcctgcacgctcgccgccctcatcctccacgacgatggcatc
cccatcacctctgagaagatcgccaccctggtgaaggcggccaacatcaaggtcgaggcc
tactggcccggtctcttcgccaagctcctcgagcaccgcagcgtcgatgacctcatcctc
tccgtcggatctggtggtggtgctgctccagttgctgctgctgctgcccctgctgctggc
ggtggtgctgctgctgccccagctgccgaggagaagaaggaggaggcgaaggaggagagc
gacgatgacatgggtttcagcttgttcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268174
Entry
9268174           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P2
  KO
K02943  large subunit ribosomal protein LP2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9268174
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9268174
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9268174
SSDB
Motif
Pfam: Ribosomal_60s Cytomega_UL84
Other DBs
NCBI-GeneID: 9268174
NCBI-ProteinID: XP_015645926
UniProt: C7J561 Q8H3F5
LinkDB
Position
7:complement(8428151..8428757)
AA seq 110 aa
MRFVAAYLMATIGGNASPTKDDVRAILGAVGADVDEDKLGYLFDQVAGKDLSEILAAGSE
MLAFGGVGAAPAAAATAGGGAAAAGEKEKEEEKVEEEEEDDIVFSLFDDE
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaggttcgtggcggcgtacctgatggccaccattggcggcaacgcgagcccgaccaag
gacgacgtgcgcgccatcctcggcgccgtcggcgccgacgtcgacgaggacaagctcggc
tacctcttcgaccaggtcgccggcaaggacctctccgagatcttggccgccgggagcgag
atgctcgccttcggcggtgtcggcgccgctccggcagccgccgccactgccggtggtggc
gccgcggcagctggtgagaaggagaaggaggaggagaaggttgaggaggaggaggaggac
gacatcgtgttcagcctcttcgacgacgaatga

DBGET integrated database retrieval system