KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275550
Entry
107275550         CDS       T01015                                 
Name
(RefSeq) adenine phosphoribosyltransferase 1-like
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107275550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107275550
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     107275550
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107275550
SSDB
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Other DBs
NCBI-GeneID: 107275550
NCBI-ProteinID: XP_015619309
UniProt: Q2QMT1 A0A8J8YFW0
LinkDB
Position
12:24820932..24822600
AA seq 188 aa
MAIAGDDSNHGVDDARIARIAAAITVFPGFPKPGISFQDVTGIFHKPEVFRDAIGLFVER
YKGKGVTLVAGIEARGFFFAPTIALEVGAKFVPLRKPRKLPGEVISEEYSLEYGTDKIEM
QIGAVEPNDRAIIVDDLIATGGTLCAAVKLLERAGAEVVECACVVELQELKGREKLGKIP
VFVLVETN
NT seq 567 nt   +upstreamnt  +downstreamnt
atggcgatcgccggagacgacagcaaccacggcgtcgacgacgcgcgcattgcgcgcatc
gccgccgccatcaccgtcttccccggcttccccaagccagggatctcgtttcaggatgtc
acgggtatatttcacaaaccggaggtattccgtgatgccatcgggctgttcgtcgagagg
tacaagggcaaaggggtcactcttgtagctggcattgaagctagagggttctttttcgct
ccaaccattgcattagaggtaggagcaaagtttgttccactaaggaagccgagaaaattg
ccaggtgaggtgatctcagaagaatattctctggaatatggaacagataaaatagaaatg
caaataggagctgtagagccaaatgatcgagctatcatcgttgatgatctcattgctacc
ggtggaaccctctgtgcagccgtcaaacttcttgaacgtgctggagcagaggtggttgag
tgtgcttgtgttgttgaacttcaagagttgaaggggagagaaaagctaggaaagatacca
gtttttgttctggtggagacaaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329972
Entry
4329972           CDS       T01015                                 
Name
(RefSeq) adenine phosphoribosyltransferase 4
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4329972
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4329972
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     4329972
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4329972
SSDB
Motif
Pfam: Pribosyltran UPRTase
Other DBs
NCBI-GeneID: 4329972
NCBI-ProteinID: XP_015623852
UniProt: Q6K5Y7 A0A0P0VLK0
LinkDB
Position
2:24223282..24228761
AA seq 238 aa
MGEEANCNVAMESAAPKENGHTTGGAAAEAKAAAAWAEIAVTDAAAVPKPTPPPAAVAVD
PRLQGISDAIRVVPHFPKQGIMFNDITPLLLRPGVFKDAVDIFVERYRGMAIAAVAGIEA
RGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYVLEYGTDCLQMHVGAIEPGERVLIV
DDLVATGGTLCAAIRLLERAGADVVECACLIGLPKFKDFYKLNGKPVYVLVESREYEK
NT seq 717 nt   +upstreamnt  +downstreamnt
atgggcgaggaggccaattgcaacgtcgcgatggagtccgctgcgcccaaggagaacggc
cacaccaccggtggcgccgcggcggaggccaaggccgccgccgcctgggctgagatcgcc
gtcaccgacgccgcggcggtgccaaagccgacgccgccgcctgcggccgtggccgtcgac
ccccggcttcagggcatctccgacgccatccgcgtcgtcccccacttccccaagcaaggc
atcatgttcaacgacatcacgccgctgctgctgcgcccgggggtgttcaaggacgccgtc
gacatcttcgtcgagcgctaccgcggcatggccatcgccgccgtcgccgggattgaggct
agggggttcatatttggcccggcgatcgcgctggcaattggcgccaaattcataccgttg
cgtaagcccaagaaactcccaggcgaggtgatttctgagacgtatgttctcgagtacggg
accgattgcttgcagatgcatgttggcgccattgaacctggtgagcgtgtgctgatcgtt
gatgatctggttgcaactggtgggacactttgtgctgctataaggcttcttgaacgcgct
ggagctgacgttgttgagtgcgcgtgtctcattgggctcccaaaatttaaggatttctac
aagctcaatggcaaaccagtttatgtgctggtggagtcccgcgaatatgaaaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336327
Entry
4336327           CDS       T01015                                 
Name
(RefSeq) adenine phosphoribosyltransferase 2
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4336327
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4336327
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     4336327
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4336327
SSDB
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Other DBs
NCBI-GeneID: 4336327
NCBI-ProteinID: XP_015637089
UniProt: Q0JBX9
LinkDB
Position
4:25165695..25170733
AA seq 212 aa
MGEEDISNDSKSSCGCEDGTVEAPAAAAPKENGRAADPRLQAISDAIRVVPHFPKPGIMF
NDITALLLRPAAFKDAVDMFVERYRGMRIAAVAGIEARGFIFGPAIALAIGAKFIPLRKP
KKLPGEVISETYILEYGTDCLEMHVGATEPGERVVVVDDLVATGGTLCAAIKLLERAGAD
VVECACLIGLPKYKNFYKLNGKPVYILVESRK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgggggaagaggatatcagcaacgacagcaagagcagctgcggctgcgaggacggcacg
gtggaggctccggcggctgcggcgccgaaggagaacggccgagccgcggacccgcgcctc
caggccatctccgacgccatccgcgtcgtcccgcacttccccaagccagggatcatgttc
aacgacatcacggcgctgctgctccggcccgccgcgttcaaggacgccgtggacatgttc
gtcgagcgctaccgcggcatgcgcatcgcggccgtcgcaggtattgaagccagaggattc
atatttggcccagcgatcgcactagcaattggagcaaaattcataccgttgcgcaaacct
aagaaactcccaggtgaggtaatttctgagacctatatacttgagtatgggacggattgt
ttggagatgcatgttggagctactgaacctggtgagcgcgtagtggtcgttgatgattta
gttgcaaccggtggaacactttgtgctgcaataaaacttcttgaacgagctggagctgac
gtagttgagtgtgcatgcctcattggccttcctaagtataagaatttctacaagctcaat
ggaaaaccagtttatatactggtggagtctcgcaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343246
Entry
4343246           CDS       T01015                                 
Name
(RefSeq) adenine phosphoribosyltransferase 4 isoform X1
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4343246
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4343246
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     4343246
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4343246
SSDB
Motif
Pfam: Pribosyltran UPRTase Gcd10p
Other DBs
NCBI-GeneID: 4343246
NCBI-ProteinID: XP_015644980
UniProt: A0A0P0X5W7 Q8H534
LinkDB
Position
7:complement(17787833..17801440)
AA seq 187 aa
MAGSEEKKEMQDPRTQAIASTIRVVPNFPKPGIMFQDITTLLLNPPVFKDTIDLFVERYT
GKGISVVAGVEARGFIFGPPIALAIGAKFIPLRKPNKLPGEVMSKEYELEYGADCLEMHV
GAVQPGERALVVDDLVATGGTLCAAIVLLERAGAEVVECACVIELPELKGRERLNGKPLY
VLVESHS
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcagggtctgaggagaagaaggagatgcaagaccccaggacacaggccatagcatcc
accattagagttgtgcccaacttccctaagccaggaataatgttccaagatatcacgacc
ctacttctaaatccccctgtgttcaaggacaccatcgacttgttcgttgaacggtacact
ggcaaaggcatctccgttgttgctggggtcgaagctagagggtttattttcggtcctccc
atagcgctcgctattggtgcaaaatttatcccactaagaaaacctaacaaacttccaggt
gaggtgatgtcaaaggagtacgagctggagtatggcgccgactgcttggaaatgcacgtc
ggcgcggtacagcccggcgagcgagcactcgtcgtcgacgacctcgtcgccaccggcggc
acgctctgtgccgccatcgtcttgcttgagcgtgctggtgcagaagtggtggagtgtgca
tgtgtgattgagctcccggaactgaagggtcgtgagaggctcaatgggaagccactgtac
gttctggtggagtctcactcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352670
Entry
4352670           CDS       T01015                                 
Name
(RefSeq) adenine phosphoribosyltransferase 1
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4352670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4352670
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     4352670
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4352670
SSDB
Motif
Pfam: Pribosyltran UPRTase
Other DBs
NCBI-GeneID: 4352670
NCBI-ProteinID: XP_015620778
UniProt: Q2QMV8 Q0IM82
LinkDB
Position
12:complement(24637059..24639845)
AA seq 240 aa
MTSPPPPPSSLLRRLPTTRCCCFASASSGWSASASVRLGSLGGKQRRGHRGVAVMAAAAA
GGGGFEARVARIASTIRVIPDFPKPGIMFQDITTMLLKPDAFRDTIELFVERYKDKGITV
IAGVEARGFIFGPPIALALGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVEPN
GRAVVVDDLIATGGTLSAAVKLIERAGAEVVECACVIELPELKGRDKLGNKPVFVLVKAD
NT seq 723 nt   +upstreamnt  +downstreamnt
atgacctcgccgccgccgccgccgtcgtcgttgctccgccgcctcccgaccacgcgctgc
tgctgctttgcctccgcgtcgagcggctggagcgcgagtgcgagcgtgcggctcggatcc
ctcggcgggaagcagcggcgggggcatcgcggcgtggcggtgatggcggcggcggcggca
gggggaggaggcttcgaggcgcgcgtggcgcggatcgcgtccaccatccgcgtcatcccc
gacttccccaagccagggattatgtttcaagatatcacaacaatgcttctcaagccagat
gcatttcgtgacacgatcgagctcttcgttgagcgatacaaggacaaagggatcactgta
attgctggtgttgaagctagaggattcatttttggtccgcccattgctttagcactaggt
gcaaaatttgttccattgaggaagccaaaaaagttacctggtgaggtgatctcggaagaa
tattctttggaatatggtacagataaaatagaaatgcatgtaggagctgtggagccaaat
ggccgggccgttgttgttgatgatctaatcgctacaggtggaaccttatctgcagccgtt
aaacttattgagcgtgctggagcagaggttgttgagtgcgcatgtgtcattgaactacca
gaactgaagggtcgggacaagctggggaacaagccagtttttgtccttgtgaaggcagac
taa

DBGET integrated database retrieval system