KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275619
Entry
107275619         CDS       T01015                                 
Name
(RefSeq) alpha-L-fucosidase 2-like
  KO
K15923  alpha-L-fucosidase 2 [EC:3.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107275619
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     107275619
SSDB
Motif
Pfam: Glyco_hyd_65N_2
Other DBs
NCBI-GeneID: 107275619
NCBI-ProteinID: XP_015613078
UniProt: Q109U3 A0A8J8YIR0
LinkDB
Position
10:complement(9861168..9868097)
AA seq 815 aa
MDGDGWVWVRRPADDDEEERPLKVVFDSPAEHFTDAAPIGNGSLGAMVWGSVASEKLQLN
HDTLWTGVPGNYTDPNAPYALAVVRKLVDGEKFVDATEAASGLFGGPTEVYQPLGDINLE
FDSSSLGYTSYKRELDLRTATVCISYNIGEVQYSREHFCSNPHQVFATKISANKSGHVSF
TLSLNSQLNHNVRITNANEMIMQGTCPGRRPALHHNGANDAIGIKFATAVGLQIGGTSAK
VTIIDDQKLRIDAADWVVLLVAAASSFDGPFVNPSESKLNPEVAALNTLNISRNATFSQL
KAAHLEDYQGLFHRVTLQLSQASMLEKDILEEVDHDVKTTAERINSFRSDEDPSLVELLF
QYGRYLLISSSRPGTQVSNLQGIWNQDFAPAWEASPHLNINLEMNYWPTLPCNLTECQEP
LFDLIGSLAVNGTKTAKVNYQASGWVTHHVTDIWAKSSAYYVDAMYALWPMGGAWLCTHL
WENYQYSLDKEFLEKRAYPLLEGCAMFLIDWLIKGPGDYLETNPSTSPEHPFIAPGTGGH
LASVSYSTTMDISIIREVFLAVISSAEVLGKSDTNLVERIKKALPMLPPVKISKDGTIME
WAQDFEDPEVHHRHLSHLFGLYPGHTITMQKNPEVCKAVANSLHKRGEDGPGWSTTWKMA
LWARLLNSENAYRMILKLITLVPPGGKVDFEGGLYTNLWTAHPPFQIDANFGFTAAIAEM
LLQSTHGDADLYLLPALPREKWPKGYVKGLRARGNVTVNISWEKGELQEATVWSSNPKCT
LRLHYGEQVAMVTVLGGNVYRFNGGLQCVETYMAP
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggacggcgacggctgggtctgggtgcggcggccggccgacgacgacgaggaggagcgg
ccgctgaaggtggtgttcgactccccggccgagcacttcacggacgcggcgcccatcggg
aacggcagcctcggagccatggtctggggcagcgtcgcctccgagaagctccagctcaac
catgataccctttggaccggcgtgcctgggaactacactgacccaaatgcgccatacgca
ctcgctgttgtgaggaagctcgttgatggagagaagtttgttgatgctacagaggctgcc
tctggccttttcggtggtccaacagaggtttaccaacctcttggagacataaatctggag
tttgactcatctagtctggggtatacttcttacaaaagagagctagatctacgtactgca
actgtttgcatcagctataatattggggaagttcagtacagtagagagcacttctgctca
aatccacaccaggtttttgccaccaagatctctgctaacaaatcaggacatgtttctttc
actttatccttaaacagtcaactaaaccacaatgttcggataacaaatgcaaatgagatg
attatgcaaggtacatgtccaggacgaagacctgcactgcatcacaatggggccaacgat
gctattggcatcaagtttgcaactgctgttgggctgcagattggtggcacttccgcaaaa
gtcacaattattgatgatcaaaagttaagaattgatgctgcagattgggttgttttgctg
gttgcagctgcttcctcattcgatgggcctttcgtgaatccttcagagtcaaaattaaac
cctgaagtagctgctctaaatacattgaatatcagcaggaatgctacattttctcagctc
aaagctgctcatttggaagattatcagggtctttttcaccgtgtaactctgcaactatcg
caagcatcaatgcttgagaaagatatcttggaagaagttgatcatgacgtaaagactaca
gcagaaagaattaattcctttagaagcgatgaggatccttctttggtcgaattgttattt
cagtatggtcgctacctgctcatttcctcctctcggcctgggacacaggtatctaatctg
caaggaatatggaaccaagattttgcacctgcttgggaggcttctcctcacctgaacata
aaccttgagatgaattactggccaacacttccttgtaaccttactgaatgccaagaacca
ctatttgacttgataggatctcttgcggttaatggaacaaaaacagcaaaagtcaattac
caagcgagtggctgggtaactcatcacgtcacggacatatgggcaaaatcatctgcatat
tacgtagatgcgatgtatgcattgtggccaatggggggtgcctggctgtgtacacatctt
tgggaaaactaccagtattcactggacaaagaatttttggagaaaagagcatatccatta
ctggagggatgtgcaatgtttttaattgattggttgatcaagggaccaggagactatttg
gaaacaaatccatctacttctccagagcatcctttcatagctcctggtactggtggtcac
cttgctagtgtgagctattcaactacaatggacatctctattatccgtgaagttttcctg
gctgtcatttcgtctgcagaggtcttgggaaaatctgatactaatctggttgaaaggatc
aagaaggcactcccaatgctccctccagttaaaatttctaaagatggcacgatcatggaa
tgggcacaagatttcgaggacccagaagtccatcatagacacctgtcacatctgtttggt
ctttaccctggtcatactataaccatgcagaaaaatcctgaggtttgcaaagctgttgcc
aatagtctccacaaacgaggggaagatggccctggatggtcgaccacatggaagatggca
ctgtgggcacgccttctgaatagtgagaatgcatacaggatgatcctaaagttgatcacc
ttggttcctcctggtggcaaggttgactttgagggaggattgtataccaatctttggaca
gcacacccacccttccaaattgatgcaaattttggattcacagctgcaattgctgaaatg
ctgctccagagcacccatggtgatgctgatctctacttgctaccagcactgccgcgcgaa
aagtggcccaaaggctacgtgaagggattgagggctcgcggcaatgtgactgtgaacatc
agctgggagaaaggggagctgcaagaagcaacggtgtggtctagcaacccaaaatgcacc
ctgaggctgcactacggtgaacaagttgctatggtgacagttttagggggcaatgtttac
aggttcaatgggggtttgcagtgcgtggagacatacatggccccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347611
Entry
4347611           CDS       T01015                                 
Name
(RefSeq) putative alpha-L-fucosidase 1
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4347611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4347611
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     4347611
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4347611
SSDB
Motif
Pfam: Alpha_L_fucos F5_F8_type_C GHL6
Other DBs
NCBI-GeneID: 4347611
NCBI-ProteinID: XP_015610897
UniProt: Q0J098 Q650T8
LinkDB
Position
9:complement(20348941..20350966)
AA seq 494 aa
MMGRCASPLCALAAALIAAVVAATSSSLAEATATPPLPVLPVPTAAQLRWQRREVIMFFH
FGMNTFTDSEWGTGREPPAAFRPAALDASQWMDAAAAAGASLVVLVAKHHDGFCLWPSAH
TAHSVRASPWRGGRGDVVREFADAARARGLDIGIYLSPWDRHDKRYGREVAYNEYYLAQL
HELLTGYGSVSEIWFDGAKGKNATNMTYHFQEWFQTVRQLQSSINIFSDDGPDLRWVGDE
NGSAGSTCWSTINRSKITIGEAGIEKYLNTGDPRGKDWVPPECDVSIRPGWFWHKNETAK
PLPELLEVYYNSVGRNCVLLLNAPPNTTGLVDAADIARLREFRTAVTAIFGTDLAAGSAA
RASSERGGRFAAANVLDGRDDTYWAPAAAEAEDGGGYWIELRRPASAAARKFNVVRIQEH
VAMGQRVERHEVYVDGGGAAVASGTTVGHKRLHRLGAPVAGRTVRVWLASRRGPPLLSAV
GLHLDPFAAGGGTM
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgatgggtcggtgcgcgtcgccgctttgcgctctcgccgccgcgctgatcgccgccgtt
gtggcggccacatcgtcgtcgttggcggaggcgacggcgacgccgccgctgccggtgctg
ccggtgccgacggcggcgcagctgaggtggcagcggcgggaggtgatcatgttcttccac
ttcgggatgaacacgttcacggactccgagtggggcacggggcgggagccgccggcggcg
ttccgcccggcggcgctggacgcgtcgcagtggatggacgcggcggccgcggcgggcgcg
tcgctcgtcgtcctcgtcgccaagcaccacgacgggttctgcctctggccgtccgcgcac
acggcgcactccgtccgcgccagcccgtggcgcggcggccgcggcgacgtcgtgcgggag
ttcgccgacgccgcgcgcgcccgcggcctcgacatcgggatctacctctcgccgtgggat
cgccacgacaagcggtacggccgcgaggtcgcctacaacgagtactacctcgcccagctc
cacgagctcctcactgggtacgggagcgtgtcggagatatggttcgacggcgccaagggg
aagaacgcgacgaacatgacgtaccatttccaggagtggttccagacggtgcggcagctg
cagagctccatcaacatcttctccgacgacggccccgacctccggtgggtcggcgacgag
aatggctccgccggatccacctgctggtccaccatcaaccgctccaagatcaccatcggc
gaggccggcatcgagaagtacctgaacaccggcgacccgagggggaaggactgggtgccg
ccggagtgcgacgtgtcgatccggccggggtggttctggcacaagaacgagacggcgaag
ccgctgccggagctgctcgaggtatactacaactcggtgggccgcaactgcgtgctgctg
ctgaacgcgccgccgaacaccacgggcctcgtcgacgccgccgacatcgccaggctgcgc
gagttccgcaccgccgtgacggccatcttcggcaccgacctcgccgcgggcagcgcggcg
agggcgagcagcgagcgcggcggcaggttcgcggcggccaacgtgctcgacggccgcgac
gacacgtactgggcaccggccgcggcggaggcggaggacggcggcgggtactggatcgag
ctgcggcggccggcgtcggcggcggcgaggaagttcaacgtggtgaggatccaggagcac
gtggcgatggggcagcgggtggagcggcacgaggtgtacgtggacggcggcggcgcggcg
gtggcgagcggcacgacggtggggcacaagcggctgcacaggctgggcgcccccgtggcg
gggcggacggtgagggtgtggctggcgtcgcggcgaggcccgccgctgctgtcggcggtg
gggctccacctcgaccccttcgccgccggcgggggcacgatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269624
Entry
9269624           CDS       T01015                                 
Name
(RefSeq) alpha-L-fucosidase 2
  KO
K15923  alpha-L-fucosidase 2 [EC:3.2.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    9269624
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     9269624
SSDB
Motif
Pfam: Glyco_hyd_65N_2
Other DBs
NCBI-GeneID: 9269624
NCBI-ProteinID: XP_015614070
UniProt: Q339Q0 A0A8J8XRD2
LinkDB
Position
10:complement(9920892..9931482)
AA seq 851 aa
MDGDGEWVWVRRPAEAEAVAAAAGWPTAEEEARPLEVVFASPSRYFTDAAPIGNGSLGAL
VWGGVASEKLQLNHDTLWTGGPGNYTNPKAPAVLSKVRDLVNRGQYAKATAVAYGLSGDQ
TQVYQPLGDIDLAFDEHVEDTNYKRNLDLRTATVNVSYTIGEVVHSREHFSSNPHQVIVT
KISADKPGNVSFTVSLTTPLNHQIRVTNANEIIMEGYCPGERPTEYGNASDHPVGIKFSA
ILYLQMSGSNGTVEILNDKMLKLVGADSAVLLLAAATSFEGPFVNPSESKLDPTASALTT
LTVARNMSYSQLKAYHVDDYQNLFQRVSLQLSRDSNDALGGNGLVNLPENSLQETSVSDY
AVQMVECSRFQGFNNSGKPTVDRILSFRDDEDPSLVELLFQFGRYLLISCSRPGTQISNL
QGIWNDETSPPWDAAPHPNINLQMNYWPALPCNLSECQEPLFDFIGSLSVNGAKTAKVNY
EASGWVSHQVTDLWAKTSPDAGDPMWALWPMGGPWLATHLWEHYSYTMDKQFLEKTAYPL
LEGSASFLLDWLIEGNGDYLETNPSTSPEHYFIAPDGRKACVSYSTTMDMSIIREVFSAV
LMSSDILGKSDSDMVQRIKKAIPRLPPIKVARDGTIMEWAQDFQDPEVHHRHVSHLFGLY
PGHTMSLEKTPDLCKAVANSLYKRGDEGPGWSTSWKMALWAHLHNSEHAYKMILQLITLV
DPKHEVEKEGGLYCNLFTAHPPFQIDANFGFPAALSEMLVQSTGSDLYLLPALPRDKWPQ
GCVKGLKARGGVTINIRWEEGSLHEALLWSSSSQNSRIKLHYGDQVGTISVSPCQVYRFS
KDLKCLKTWAL
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggacggcgacggcgagtgggtgtgggtgcggcggccggcggaggcggaggccgtggcg
gcggcggcggggtggccgacggcggaggaggaggcgcggccgctggaggtggtgtttgcg
tcgccgtcgaggtacttcacggacgcggcgcccatcgggaacggcagcctcggcgccctg
gtgtggggcggcgtcgcatccgagaagctacagctcaaccatgacactctatggacgggt
ggacctggtaattatacaaacccaaaagcacctgcagttctttctaaagtaagggacctt
gttaacaggggacagtatgctaaagccacggctgttgcttatggcctatctggtgaccaa
acacaggtataccagcctcttggtgatattgatctggcctttgatgaacacgtggaggac
acaaattataaaagaaacctagatcttcgaacagcaactgttaatgtctcttacaccatt
ggtgaggtggtccactcaagggaacacttctcatcaaatccacatcaagtcatcgtgact
aaaatatctgcagataaacctggaaatgtctcctttacagtgtctttgactactccattg
aaccaccagattcgtgtaacaaatgcaaacgaaataataatggaaggttattgcccagga
gaaaggcccacagaatatggcaatgcctctgatcatcccgttggaattaagttttctgct
attctctatctgcagatgagtggttccaatggcactgtggaaatattaaatgataagatg
ctgaaacttgttggtgccgactcagctgtgttgctccttgcagctgctacttcatttgaa
gggccatttgtcaatccttcggaatctaaactggatccaactgcatctgctctgacaaca
ctaactgtggcaaggaacatgtcatattcacagctaaaagcttatcacgtggatgattac
cagaatcttttccagcgagtttccttgcaactttcacgagactctaatgatgcccttgga
gggaatggtttagttaatttacctgagaatagcttacaggaaacctctgtatctgattat
gctgtacagatggtagagtgctcaagatttcaggggtttaataattcaggcaagcctacc
gtagacagaattctaagttttagagacgatgaagatccttctctggtggaactcctgttc
caatttggtcgttatctactcatttcttgctcaaggcctggaacccagatttccaatctt
caaggaatatggaatgatgaaacttcaccaccatgggatgcagctccccatccaaatata
aatctacaaatgaattattggccggcacttccttgcaaccttagcgaatgccaagaacca
ctattcgacttcattggatctctttcagttaatggagctaagacagcaaaagtaaattat
gaagctagcggttgggtcagtcatcaagtgactgacctgtgggctaaaacatcaccagat
gctggtgaccctatgtgggccttatggccaatgggtgggccatggcttgccacacacctg
tgggagcattacagttatacgatggacaaacaatttttggagaaaacagcatatcccctt
ttggaagggtctgcatcatttctgttggactggttgattgagggaaatggagattatttg
gagaccaatccttccacttctccagagcattatttcattgctccagatggtaggaaggcc
tgcgtgagctactcaacaactatggacatgtcaattataagagaagttttctcagctgtt
cttatgtcttcagatattttaggaaagtcagactcagacatggttcagagaatcaaaaaa
gcaataccaaggctcccaccaataaaagttgcaagagatggtacaatcatggagtgggca
caggattttcaggatcctgaagttcaccacagacatgtatctcacctgtttggtctttat
ccaggacatactatgtcacttgagaaaacacctgacctttgcaaagccgttgcaaatagt
ctctataaaagaggtgatgaaggtcctgggtggtccacttcctggaagatggccctttgg
gcccatcttcataacagtgagcatgcatataaaatgattcttcagctgatcactttggta
gatccaaaacatgaggttgaaaaggaaggaggcctatactgcaatctgttcacagcacac
ccacctttccaaattgatgcaaattttggattccctgctgcactgtcagaaatgctggta
cagagcaccgggagcgacttgtacttgctccctgccttaccccgtgataagtggcctcaa
ggttgtgtgaaaggtctcaaggcccgaggcggtgtgaccatcaacatcaggtgggaggaa
ggtagcctccatgaagctctgctttggtccagcagcagccagaattcacgtatcaagctg
cactatggagatcaggttgggacgatcagtgtctcgccttgtcaagtttacaggttcagc
aaggatctgaagtgcttgaagacttgggctctctga

DBGET integrated database retrieval system