KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275635
Entry
107275635         CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate synthase 7-like
  KO
K01762  1-aminocyclopropane-1-carboxylate synthase [EC:4.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107275635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    107275635
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.14  1-aminocyclopropane-1-carboxylate synthase
     107275635
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   107275635
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-GeneID: 107275635
NCBI-ProteinID: XP_015638322
UniProt: Q5W6F9
LinkDB
Position
5:complement(14821647..14824552)
AA seq 496 aa
MGVKLLADGCAGASSSPALSRVATSAAHGEGSPYFAGWKAYDEDPYDAAANPDGVIQMGL
AENQVSIDLLEGYLREHPEAAAWGVAGDGGGDSFRDNALFQDYHGLANFRKAMARFMEKI
MGGKATFDPDRIVLTAGATAANELLTFILADPRDALLIPTPYYPGFDRDLRWRTGVNVVP
VHCDSANGFQVTAAALQAAHDEAAAAGMRVRGVLITNPSNPLGTTARREALEGILGFVAR
NDIHLVSDEIYSGSVFAAPDLVSVAELVESSSSRARHRGEDDDGDVGVADRVHVVYSLSK
DLGLPGFRVGVVYSRNDAVVAAARRMSSFTLVSSQTQRTLAAVLSDEAFVDAYVAANRAR
LRERHDHVVAGLARAGVPCLRGNAGLFVWMDMRRLLLGDGGDAATFAGELRLWDRLLREV
KLNVSPGSSCHCSEPGWFRVCFANMSLATLDVALERISRFMDAWCKATIGKFNHLQPNRC
EVNYFALERYQGHVQQ
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgggtgtcaagctgttggctgacggctgcgccggcgcctcgtcgtcgcctgcgctgtcg
cgggtggcgacctccgcggcgcacggcgagggctccccctacttcgccgggtggaaggcc
tacgacgaagacccctacgacgccgccgcgaacccggacggcgtcatccagatgggcctc
gccgagaaccaggtctccatcgacctcctcgagggctacctccgggagcacccggaggcc
gccgcctggggcgtcgccggcgacggcggcggcgacagcttcagggacaatgcgctgttc
caggactaccatggcctcgccaacttcaggaaggcgatggcaagattcatggagaagata
atgggtggcaaggcgacgttcgaccccgaccgcatcgtcctcactgccggagcgacggcg
gccaacgagctcctcaccttcatcctcgccgaccccagagacgccctgctgatccctacc
ccttactatccagggttcgacagggacctgaggtggaggacgggcgtcaacgtcgtgccg
gtgcactgcgacagcgcgaacgggttccaggtcacggccgccgcgctccaggcggcgcac
gacgaggccgccgcggcgggcatgcgcgtccgcggcgtcctgatcacgaacccgtccaac
ccgctcggcaccacggcgaggcgcgaggcgctcgagggcatcctcggcttcgtggcgcgc
aacgacatccacctcgtctccgacgagatctactccggctccgtcttcgccgcgccggac
ctcgtcagcgtggcggagctcgtcgagtcgtcgtcctcgcgcgcacggcaccgcggcgag
gacgacgacggcgacgtcggcgtcgccgaccgcgtgcacgtcgtgtacagcctgtccaag
gacctgggcctcccggggttccgcgtcggcgtggtgtactcgcgcaacgacgccgtggtc
gccgcggcgcggcgcatgtcgagcttcaccctcgtgtcgtcgcagacgcagaggacgctg
gccgccgtgctgtccgacgaggcgttcgtcgacgcctacgtcgccgccaaccgggcgcgc
ctccgggagcggcacgaccacgtcgtggcggggctggcccgcgccggcgtgccgtgcctg
cgcggcaacgccgggctgttcgtgtggatggacatgcggcggctcctgctcggcgacggc
ggcgacgccgcgaccttcgccggcgagctgaggctgtgggacaggctgctgcgcgaggtg
aagctcaacgtctcgccgggctcgtcgtgccattgctcggagcccggctggttcagggtg
tgcttcgcgaacatgagcctggccaccctggatgttgcgctggagaggataagccgcttc
atggacgcgtggtgcaaagcaacaattgggaaatttaaccatttgcaacccaacagatgt
gaggtgaattattttgcacttgagaggtaccaagggcatgtgcaacagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275928
Entry
107275928         CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate synthase 7-like
  KO
K01762  1-aminocyclopropane-1-carboxylate synthase [EC:4.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107275928
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    107275928
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.14  1-aminocyclopropane-1-carboxylate synthase
     107275928
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   107275928
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 107275928
NCBI-ProteinID: XP_015639403
UniProt: A0A0P0WIY3
LinkDB
Position
5:complement(5954216..5956406)
AA seq 452 aa
MVGRMLSSPEPTLSTMAMSAAHGEDSPYFAGWRAYDEDPYDPITNPQGVIQMGLAENQVS
FDLLEEYMREHPEASDCGAGVRENALFQDYHGLKSFRKAMASFMETIRGGKARFDPDRVV
LTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVNIVPVSCDSAAGFQVTA
GALRAAYDEAVAAGTRVRGVLITNPSNPLGTTAARGVLEGILDFVARHDMHLISDEIYSG
SVFAAPDLVSVAELVDERRRARGGAADAEDIARRVHVVYSLSKDLGLPGFRVGVVYSYND
AVVAAARRMSSFTLVSSQTQRTLAAMLSDAAFAAAYVRSNRDRLRERHARAVAGLRRAGV
ACLRGANAGLFVWVDMRRLLGDGEATVAGELRLWRRVVAEAKLNISPGSSCHCREPGWFR
VCFANMSLETLDVALHRLGCFIKKWEQEQHEN
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggttggcaggatgctttcttccccagagcctacactgtcaaccatggcgatgtcggcg
gctcacggcgaggactcgccgtactttgcagggtggagagcctatgatgaggacccctat
gaccccatcaccaatcctcaaggtgtcatacagatgggccttgcagaaaaccaggtttcc
tttgatcttctagaggaatacatgagggagcacccggaggcgtcggattgcggcgccggg
gttcgagagaacgccctgttccaggactaccatggcctgaaatcattcaggaaggcaatg
gcgagcttcatggagacgataaggggaggcaaggcgaggttcgacccggaccgcgtcgtc
ctcaccgccggcgccaccgccgccaacgagcttctcaccttcatcctcgccgaccccggc
gacgccctcctcgtccctaccccttactacccagggtttgacagggacttgaggtggagg
accggcgtgaacatcgtcccggtgagctgcgacagcgccgccgggttccaggtcaccgcc
ggcgcgctccgggccgcgtacgacgaggccgtggcggcggggacgcgcgtccgcggcgtg
ctcatcacgaacccgtcgaacccgctcggcacgacggcggcgcgtggcgtcctcgagggc
atcctcgacttcgtggcgcgccacgacatgcacctcatctccgacgagatctactccggc
tccgtgttcgccgcgccggacctggtcagcgtcgcggagctcgtcgacgagcgccgccgc
gcgcgcggcggcgccgccgacgccgaggacatcgcccggcgcgtccacgtcgtgtacagc
ctctccaaggacctgggcctcccggggttccgcgtcggcgtggtctactcctacaacgac
gccgtggtggccgcggcgaggcgcatgtcgagcttcacgctggtgtcgtcgcagacgcag
cggacgctcgccgcgatgctgtccgacgcggcgttcgcggcggcgtacgtgcgctccaac
cgcgaccgcctccgggagcggcacgcgcgcgcggtggccgggctgcggcgcgccggcgtg
gcgtgcctccgaggcgccaacgccgggctgttcgtgtgggtggacatgcgccgcctgctg
ggcgacggcgaggccaccgtcgccggcgagctgaggctgtggcggcgcgtggtcgccgag
gcgaagctgaacatctcgccggggtcgtcgtgccattgccgggagccggggtggttcagg
gtgtgcttcgccaacatgagcttggagacgctggacgttgcactccatagactgggctgc
ttcatcaagaaatgggagcaagaacaacatgagaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327307
Entry
4327307           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate synthase 7
  KO
K01762  1-aminocyclopropane-1-carboxylate synthase [EC:4.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4327307
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4327307
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.14  1-aminocyclopropane-1-carboxylate synthase
     4327307
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4327307
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-GeneID: 4327307
NCBI-ProteinID: XP_015629495
LinkDB
Position
1:complement(5002118..5004414)
AA seq 461 aa
MGGKLLPAAAFAGSAPPLSQVATSAAHGEDSPYFAGWKAYDEDPYHAVDNPDGVIQMGLA
ENQVSFDLLEAYLRDHPEAAGWSTGGAGAGSFRDNALFQDYHGLKSFRKAMASFMGKIRG
GKARFDPDHIVLTAGATAANELLTFILANPGDALLIPTPYYPGFDRDLRWRTGVNIVPVR
CDSANGFQVTVAALQAAYDEAAAVGMRARAVLITNPSNPLGTTVRRKMLDDILDFVSRND
IHLISDEIYSGSVFAAPDLVSVAELVEARGGDGIAGRVHIVYSLSKDLGLPGFRVGVVYS
YNDAVVTAARRMSSFTLVSSQTQKTLAAMLSDEAFAGEYIRTNRRRLRERHEHVVAGLAR
AGVPCLRGNAGLFVWMDMRRLLLGGGGVGGELRLWEKLLRQAKLNISPGSSCHCSEAGWF
RVCFANMSLDTLDLALHRISRFMDTWNGTKQQASCQQQEQQ
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgggtggcaagctgttgcctgctgcggcgttcgccgggtcggcgccgccgctgtcgcag
gtggcaacgtcggcggcgcacggcgaggactcgccgtacttcgccgggtggaaggcctac
gacgaggacccctaccacgccgtcgataaccccgacggcgtcatacagatgggcctcgcc
gagaaccaggtctccttcgacctcctcgaggcctacctccgtgaccacccggaggccgcc
ggctggagcaccggcggcgccggcgccggtagcttcagggacaacgcgctgttccaggat
taccatggcctcaagagcttcaggaaggcgatggcgagcttcatggggaagatacgcggc
ggcaaggcgaggtttgaccccgaccacatcgtgctcaccgccggcgccaccgccgccaac
gagctcctcaccttcatcctcgccaaccccggcgacgccctgctcatccctaccccttac
taccccgggtttgacagggacttgaggtggaggacgggggtgaacatcgtgccggtgcgg
tgcgacagcgcgaacgggttccaggtcacggtcgccgcgctccaggcggcgtacgacgag
gccgccgcggtggggatgcgcgcccgcgccgtcctgatcaccaacccctccaacccgctc
ggcaccacggtcaggcgcaagatgctcgacgacatcctcgacttcgtgtcgcgcaacgac
atccacctcatctccgacgagatctactccggctccgtcttcgccgcgccggacctcgtc
agcgtggcggagctcgtcgaggcgcgcggcggcgacggcatcgccggccgcgtccacatc
gtctacagcctctccaaggacctgggcctcccggggttccgcgtcggcgtggtctactcc
tacaacgacgccgtcgtgacggcggcgcggcggatgtcgagcttcacgctggtgtcgtcg
cagacgcagaagacgctggcggcgatgctgtccgacgaggcgttcgccggggagtacatc
cgcaccaaccgccgccggctccgggagcggcacgagcacgtggtggccgggctggcgcgc
gccggcgtgccgtgcctgcgcggcaatgctgggctgttcgtgtggatggacatgcggcgg
ctgctgctcggcggcggcggcgtcggcggcgagctgaggctgtgggagaagctgctgcgc
caggcgaagctgaacatctcgccggggtcgtcgtgccattgctcggaggccggctggttc
agggtgtgcttcgccaacatgagcttggacacgctggatcttgcactccacaggataagc
cgcttcatggacacgtggaatggaacaaagcaacaagctagctgccagcagcaagaacag
caataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333976
Entry
4333976           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate synthase 1
  KO
K01762  1-aminocyclopropane-1-carboxylate synthase [EC:4.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4333976
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4333976
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.14  1-aminocyclopropane-1-carboxylate synthase
     4333976
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4333976
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4333976
NCBI-ProteinID: XP_015629245
UniProt: Q10DK7
LinkDB
Position
3:complement(29660661..29662959)
AA seq 487 aa
MVSQVVAEEKPQLLSKKAGCNSHGQDSSYFLGWQEYEKNPFDPVSNPSGIIQMGLAENQL
SFDLLEEWLEKNPHALGLRREGGGASVFRELALFQDYHGLPAFKNALARFMSEQRGYKVV
FDPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRTGAEIVPVHCASA
NGFRVTRPALDDAYRRAQKRRLRVKGVLITNPSNPLGTASPRADLETIVDFVAAKGIHLI
SDEIYAGTAFAEPPAGFVSALEVVAGRDGGGADVSDRVHVVYSLSKDLGLPGFRVGAIYS
ANAAVVSAATKMSSFGLVSSQTQYLLAALLGDRDFTRSYVAENKRRIKERHDQLVDGLRE
IGIGCLPSNAGLFCWVDMSHLMRSRSFAGEMELWKKVVFEVGLNISPGSSCHCREPGWFR
VCFANMSAKTLDVAMQRLRSFVDSATGGGDNAALRRAAVPVRSVSCPLAIKWALRLTPSI
ADRKAER
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggtgagccaagtggtcgccgaggagaagccgcagctgctgtccaagaaggccgggtgc
aacagccacggccaggactcgtcctacttcctggggtggcaggagtacgagaaaaacccg
ttcgaccccgtctccaacccttccggcatcatccagatgggcctcgccgagaaccagctg
tcgttcgacctgcttgaggagtggctggagaagaacccccacgcgctcggcctccggcga
gagggcggcggcgcctccgtcttccgcgagctcgcgctgttccaggactaccacggcctc
ccggctttcaaaaatgcattggcgcggttcatgtcggagcagagagggtacaaggtggtg
ttcgaccccagcaacatcgtgctcaccgccggcgccacctcggctaacgaggcgctcatg
ttctgcctcgccgaccacggcgacgccttcctcatccccaccccatactacccagggttc
gaccgcgacctcaagtggcgcaccggcgcggagatcgtacccgtgcactgcgcgagcgcg
aacgggttccgggtgacgcgccccgcgctggacgacgcgtaccgccgcgcgcagaagcgc
cggctgcgcgtcaagggggtgctgatcaccaacccgtccaacccgctcggcaccgcgtcg
ccgcgcgccgacctcgagacgatcgtcgacttcgtcgccgccaagggcatccacctcatc
agcgacgagatctacgccggcacggcgttcgccgagccgcccgcgggcttcgtcagcgcg
ctcgaggtcgtggccgggcgcgacggcggcggcgctgacgtgtccgaccgcgtgcacgtc
gtgtacagcctgtccaaggacctcggcctcccggggttccgcgtcggcgccatctactcc
gccaacgccgccgtcgtgtccgcggcgaccaagatgtccagcttcggcctcgtgtcgtcc
cagacgcagtacctcctcgcggcgctgctcggcgacagggacttcacccggagctacgtc
gcggagaacaagcggcggatcaaggagcggcacgaccagctcgtggacgggctcagggag
atcggcattgggtgcctgcccagcaacgccggcctcttctgctgggtggacatgagccac
ctgatgcggagccggtcgttcgccggcgagatggagctctggaagaaggtggtgttcgag
gtcggcctcaacatctcccccgggtcgtcgtgccactgccgcgagcccggctggttccgc
gtctgcttcgccaacatgtcggccaagaccctcgacgtcgccatgcagcgcctcaggtcg
ttcgtcgactccgccaccggcggcggcgacaacgccgccctccgccgcgccgccgtcccc
gtcaggagcgtcagctgcccgctcgccatcaagtgggcgctccgcctcaccccgtccatc
gccgaccggaaggccgagagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336750
Entry
4336750           CDS       T01015                                 
Name
(RefSeq) 1-aminocyclopropane-1-carboxylate synthase
  KO
K20772  1-aminocyclopropane-1-carboxylate synthase 1/2/6 [EC:4.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04016  MAPK signaling pathway - plant
Module
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4336750
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4336750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4336750
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.14  1-aminocyclopropane-1-carboxylate synthase
     4336750
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4336750
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4336750
NCBI-ProteinID: XP_015634087
UniProt: Q7XQ85
LinkDB
Position
4:complement(29131808..29134739)
AA seq 483 aa
MAYQGIDLLSTKAAGDDHGENSSYFDGWKAYDTNPFDLRHNRGGVIQMGLAENQLSLDLI
EEWSKNHPEASICTPEGVSQFKRIANFQDYHGLPEFRKAMAQFMGQVRGGKATFDPDRVV
MSGGATGAQETLAFCLANPGEAFLVPTPYYPAFDRDCCWRSGIKLLPIECHSFNDFRLTK
EALVSAYDGARRQGISVKGILITNPSNPLGTITDRDTLAMLATFATEHRVHLVCDEIYAG
SVFATPEYVSIAEVIERDVPWCNRDLIHVVYSLSKDFGLPGFRVGIIYSYNDAVVAAARR
MSSFGLVSSQTQYFLARMLSDEEFIGRFLQESKCRLVARHERFTSGLREVGIGCLRGNAG
LFSWMDLRRMLREKTAEAELELWRVIVHQVKLNVSPGTSFHCREPGWFRVCHANMDDETM
EVALGRIHDFVRQHQQRRVKAERWAANRQLRLSLPHHHHLSPAHLSSPLALLSPQSPMVR
ATS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggcgtaccagggcatcgaccttctctcgacgaaagccgcaggcgatgaccacggcgag
aattcatcgtacttcgacgggtggaaggcctacgacacgaacccgttcgacctgcggcac
aatcgcgggggtgtcatccagatgggtctcgccgagaaccagctttctctggacctgatc
gaggaatggagcaagaaccaccccgaggcatccatttgcacaccggagggcgtctcgcag
ttcaagaggatcgccaatttccaggattaccacggcctcccggagttcagaaaggcgatg
gcccagtttatggggcaggtgaggggaggcaaggcaacgtttgaccccgaccgtgtcgtc
atgagcggcggcgccaccggcgcccaggagacgctcgccttctgcctcgccaaccccggc
gaggccttcctcgtgcccacgccatactacccagctttcgaccgcgactgttgctggagg
tcaggaataaagctgctgccgatcgagtgccacagcttcaacgacttcaggctcaccaag
gaggccctcgtgtcggcgtacgacggcgcacggaggcagggcatctccgtcaaggggatc
ctcatcaccaacccgtccaacccgctcggcaccatcaccgaccgcgacacgctggccatg
ctcgccaccttcgccaccgagcaccgcgtccacctcgtctgcgacgagatctacgcgggg
tcggtgttcgccacgccggagtacgtgagcatcgccgaggtcatcgagcgcgacgtgccg
tggtgcaacagggacctgatccacgtcgtgtacagcctctccaaggacttcggcctcccc
ggcttccgcgtcggcatcatctactcgtacaacgacgccgtcgtggcggccgcgcgcagg
atgtccagcttcgggctcgtctcgtcgcagacgcagtacttcctcgccaggatgctctcg
gacgaggagttcatcggccgcttcctccaggagagcaagtgtcggctggtggcgcggcac
gagcggttcacctctggcctccgcgaggtcgggatcggctgcctgcgcggcaacgccggg
ctgttctcgtggatggacctgcgccgcatgctccgggagaagacggccgaggcggagctg
gagctgtggcgggtgatcgtacaccaggtgaagctgaacgtgtcgcccggcacgtcgttc
cactgccgcgagcccgggtggttccgcgtctgccacgccaacatggacgacgagaccatg
gaggtcgcgctcggccggatccacgacttcgtgcgccagcaccagcagcgcagggtcaag
gccgagcgctgggccgccaataggcagctccgcctcagcctgccgcaccaccaccacctc
agcccagcccatctctccagtccattggcgctcctgtcgccgcagtccccgatggttcgc
gccaccagctga

DBGET integrated database retrieval system