KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275655
Entry
107275655         CDS       T01015                                 
Name
(RefSeq) SNW/SKI-interacting protein-like
  KO
K06063  SNW domain-containing protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107275655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    107275655
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    107275655
 Complex C
    107275655
SSDB
Motif
Pfam: SKIP_SNW TPD52 DUF2335
Other DBs
NCBI-GeneID: 107275655
NCBI-ProteinID: XP_015642244
UniProt: Q69QB5
LinkDB
Position
6:6027425..6029529
AA seq 540 aa
MVLRLPDPSHGGGAPPHDHTEDEWFKERYGGGGGGGDAPRSSRAVNPVPPYGRRSALAPR
RKEDFGDGGAFPEVHVAQYPLDMGRRGGDGDGEQRGSSGGVLSLTVDGSGGRVEFDAVVR
QGENAGKTVYSSPGDVLPKINAAAADADDDEQAAVEETTARTSAALRAIVEKRLSAVQPS
NTLASNHDPEFIKYTPARQTSAFNSGAAERIIRMGETQQDPLEPPKFKHKRVPAPAGSPP
VPVLRSPPRPPSQKDHDDWKVPPSISSWKNPKGYSIPLDKRAALDGRGLHDVQVSDAFAA
LAEALYAAEQKAREAVETRAKVHTEMKMREKEKAEQHLLQLATKARAEMLGAAPPAPSER
SKAAAERDAIREERRRERRLEARAAAAAASKKSAATRDRDRDVSERIALGMANTGGGGGE
VTYDQRLFNQEKGMGSGFAGDDQYNVYSGRLFAAQPALSTLYKPSKHGEEDPDAYGDADE
HLGKIAKTRRFVPDKAFTGAPASVAAGKRERPVEFDGPEMEEDPFHLDQFLTQMKKGKHQ
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggttctccggctgcctgacccctcgcacggcggcggcgcgccgccgcacgaccacacc
gaggacgagtggttcaaggagcggtacggcggcggcggcggcggaggggacgcgccgagg
tcgtcgagggcggtgaatcccgtgccgccctacgggaggcgatcggcgctcgcgcctcgg
aggaaggaggacttcggcgacggcggcgccttccccgaggtccacgtcgcgcagtacccg
ctcgacatgggccgccgcggcggcgacggcgacggggagcagcgggggtcttccggcggc
gtgctcagcctcaccgtcgatgggagcggcggccgcgtcgagttcgacgccgtcgtgaga
cagggggagaacgccgggaagaccgtgtactccagccccggcgacgtcttgcccaagatc
aacgccgccgccgccgacgccgacgatgacgagcaggcggccgtggaggagaccacggcg
cggacgagcgccgcgctgcgtgcgatcgtcgagaaacgcctctccgccgtgcagccgtcg
aacaccctggccagcaaccacgacccggaattcatcaagtacacgcctgcgcggcagaca
tcggcgttcaactccggcgcggcggagaggatcatccggatgggggagacccagcaggac
ccgctcgagccgcccaagttcaagcacaagcgagtgcccgcccccgccgggtcgccgccg
gtgccagtgctgcgctcgccgccgcggccaccgtcgcagaaggaccacgacgactggaag
gtgccgcccagcatctcgagctggaagaaccccaagggctactccatcccgctcgacaag
cgtgcggcgttggacggccgcggcctgcacgacgtccaggtgagcgacgccttcgccgcg
ctcgccgaggcgctgtacgccgccgagcagaaggcccgggaggccgtcgagacgcgcgcc
aaggtacacaccgagatgaagatgagggagaaggagaaggccgagcagcatctcctccag
ctcgccacgaaggcgcgcgcggagatgctcggcgccgctcctccggcgccgagcgagcgg
tcgaaggcggcagcagagcgcgacgcgatacgcgaggagcggaggcgcgagaggcggctc
gaggcgagggccgccgccgccgcggcgagcaagaagagcgcggccacccgggacagggac
cgcgacgtcagcgagaggatcgccctgggcatggcgaacaccggcggcggcggcggcgag
gtcacctacgaccagcggctgttcaaccaggagaagggaatgggctccgggttcgccggc
gacgaccagtacaacgtctactccgggaggctcttcgcggcgcagccggcgctgtcgacg
ctctacaagccgagcaagcacggcgaggaggaccctgacgcctacggcgacgccgacgag
cacctcgggaagattgccaagacacgcaggttcgtgcccgacaaggcgttcaccggagct
ccggcgagcgtggccgccggcaagagggagaggcccgtcgagtttgacgggccggagatg
gaggaggatccgttccaccttgatcagttcttgactcagatgaagaaggggaagcatcag
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330796
Entry
4330796           CDS       T01015                                 
Name
(RefSeq) SNW/SKI-interacting protein
  KO
K06063  SNW domain-containing protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4330796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4330796
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4330796
 Complex C
    4330796
SSDB
Motif
Pfam: SKIP_SNW CD99L2
Other DBs
NCBI-GeneID: 4330796
NCBI-ProteinID: XP_015626352
UniProt: Q6K8D9
LinkDB
Position
2:complement(31995311..31997705)
AA seq 607 aa
MASLKELLPTPKAAASTFYDHSSDPWFKERYGGESAQSDAAAAAAKPSGPAKPVPPYGKR
GGFVPRRPEDFGDGGAFPEIHVAQYPLGMGRRDEKGGSKILALTVDAKGSVAFDAVVKQG
ENASKIVYSKHSDLVPKIATADSEATADDEEYQKQIEETTERTKAALEKVVNVRLSAAQP
KNVPTHDSESKFIKYKPSQQSAAFNSGAKERIIRMSEMAQDPLEPPKFKHKRVPRASGSP
PVPVMHSPPRPVTVKDQQDWKIPPCISNWKNPKGYTIPLDKRLAADGRGLQEVQINDNFA
KLSEALYVAEQKAREAVQMRSKVQRELQLKEKERKEQELRALAQKARMERTGAPPAPTGV
PAGGGRGAVDDREEDMDLEQPREQRRESREEREARIERDRIREERRRERERERRLEARDA
AMGKKSKLTRDRDRDVSEKIALGMASTGGAKGGEVMYDQRLFNQDKGMDSGFATDDQYNI
YSKGLFTAQPTLSTLYRPKKDGDSDVYGDADEQLEKVMKTDRFKPDKGFSGASERSGKRD
RPVEFDKQEENDPFGLDQFLTEVKKGKKAVEKIGSGGAMRASGGSSMRDDYEGGGSGRSR
INFERGR
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggcgtccctcaaggagctcctcccgacgcccaaggcggcggcgtcgacgttctacgac
cacagcagcgacccgtggttcaaggagcggtatggcggggagtcggcgcaatccgacgcg
gcggcggcggcggcgaagccttcgggccccgccaagcccgtgccgccgtacgggaagcgt
ggcgggttcgtgccgcggcggccggaggacttcggggacggcggcgccttcccggagatc
cacgtcgcgcagtacccgctcggcatgggccggcgcgacgagaagggcggctcgaagatc
ctcgcgctcaccgtcgacgccaagggcagcgtcgccttcgacgccgtcgtgaagcagggt
gagaacgcctctaagatcgtttactcaaagcacagcgacctcgtgcccaagattgccacg
gctgattccgaggcaaccgcggacgacgaggagtaccagaaacagatcgaagaaaccact
gaacgaactaaagctgccttggagaaggttgtcaatgttcggctctccgccgcacagccc
aagaatgtgccgacgcatgattcagagtcaaagtttatcaagtataagccatcgcagcaa
tcggcagccttcaattcaggtgccaaggagaggattattaggatgtcagagatggctcag
gatcctcttgagccaccgaaattcaagcataagcgagtgccccgcgcttctggatcaccg
cctgtcccagtgatgcactcgccaccacggccagtgacagtgaaggaccagcaagattgg
aagattccaccatgcatttcaaattggaaaaatccaaagggttacaccataccactcgac
aagaggttggcagctgatggaagggggctgcaggaggttcaaattaatgataactttgca
aagctctctgaagcactgtatgtggcggagcagaaggccagggaggcagtacagatgcga
tccaaggtgcagagggagctgcagctgaaggagaaggagaggaaggagcaagagctaagg
gcacttgcacagaaggcgcgcatggagaggactggtgccccacctgcacctacaggggtt
cctgctggtggtggtagaggtgctgttgatgacagggaggaagatatggatttggagcag
cctcgtgagcaacgaagggagagtagagaagaaagggaagcaaggattgagcgtgacagg
attcgtgaggagaggagacgtgagagggagagagagaggaggctggaggccagggatgct
gcaatgggcaagaagagtaagctcactagagacagggatcgtgatgtcagtgagaagatt
gccctgggcatggcaagcactggcggtgctaaaggtggggaagtcatgtatgaccagagg
ttgttcaaccaggataaaggaatggactctgggtttgctacagatgatcagtataacatc
tactccaagggtctcttcacagcgcagccaacgctatccacactttacaggcctaagaag
gacggtgattctgatgtgtatggcgatgcagatgaacaactggagaaggttatgaagaca
gataggttcaaaccagacaaaggattttctggtgcttcagagaggtctggaaagagagac
agacctgtggagtttgataaacaggaggagaatgatcccttcggtcttgatcagttcttg
actgaagtgaagaaggggaagaaagctgttgagaagattggaagcggaggagccatgagg
gcaagtggtggatcctcaatgagagatgattacgagggtggaggatctgggaggtcccgc
attaactttgaaagaggtcgttga

DBGET integrated database retrieval system