KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275673
Entry
107275673         CDS       T01015                                 
Name
(RefSeq) DNA replication licensing factor MCM4
  KO
K02212  DNA replication licensing factor MCM4 [EC:5.6.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107275673
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    107275673
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     107275673
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    107275673
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3
Other DBs
NCBI-GeneID: 107275673
NCBI-ProteinID: XP_015630179
UniProt: Q5JKB0
LinkDB
Position
1:20191966..20197023
AA seq 862 aa
MASRGGGGGGDGNSPPPSVSSPDVRPSSPLPATNSSPPQSGRRGGGRRRRGSASPYPSSP
SLGGFETPPHPGRRTPSGGAAARQQRQNWTGGRFPPTPSTPMSTDDVPLSSEAGDEDTPE
TDGGGGGGAGADATPVFVWGTNISVQDVNAAILRFLRHFRDPRDAGRVDPVMDEGKYMRA
IHRILELEGGESLDVNAHDVFDHDPDLYGKMVRYPLEVLAIFDIVLMDLVARIEPLFEKH
IQTRIYNLKSSVCLRNLNPSDIEKMVSIKGMIIRCSSVIPELKEAVFRCLVCGFYSEPVM
VDRGRVTEPHICQKEQCKATNSMTLVHNRCRFADKQIIKLQETPDEIPEGGTPHTVSVLM
HDKLVDAGKPGDRVEITGIYRAMSIRVGPTQRTVKSIFKTYIDCLHIKKTDKSRLHVEDS
METDNPNANKTTEDDFLRDKVEKLKELSKLPDIYDRLTRSLAPNIWELDDVKRGLLCQLF
GGNALRLPSGASFRGDINILLVGDPGTSKSQLLQYMHKLSPRGIYTSGRGSSAVGLTAYV
TKDPETGETVLESGALVLSDKGVCCIDEFDKMSDNARSMLHEVMEQQTVSIAKAGIIASL
NARTSVLACANPTESRYNPRLSVIDNIHLPPTLLSRFDLIYLILDKADEQTDRRLAKHIV
SLHFENPNIEELEVLDLPTLVAYISYARKHIQPQLSDEAAEELTRGYVEMRKRGNSPGSR
KKVITATARQIESLIRLSEALARMRFSEMVEVQDVVEAFRLLEVAMQQSATDHATGTIDM
DLIMTGISASERQRRDNLVAATRNLVMEKMQLGGPSVRMIELLEEIRKQSSMEVHLHDLR
GALGTLMTEGAVVIHGDSVKRV
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggcgtctcgcggcggtggcggcggcggcgacggcaattcccctcctccctccgtgtcg
tcgccggatgtgcgaccgtcgagccctctcccggcgaccaactcctccccgcctcagtcg
gggcggcgcggcggggggcggcgccggcgtggttccgccagcccgtacccgtcgtccccg
tccctcggcgggttcgagacgccgccgcacccgggccgccgcacgccctccggcggcgcg
gcggcgcggcagcagcggcagaactggacgggggggcggttcccgccgaccccgtccacc
cccatgtccaccgacgacgtcccgctctcctcggaggccggggacgaggacacccccgag
accgacggcggcggcggcggcggcgcgggcgccgacgccacgccggtgttcgtctggggc
accaacatcagcgtgcaggacgtcaacgccgccatcctccggttcctccgccacttccgc
gacccgcgcgacgccggccgcgtcgacccggtcatggacgagggcaagtacatgcgcgcc
atccaccgcatcctcgagctcgagggcggggagtcgctcgacgtcaacgcccacgacgtg
ttcgaccacgacccggacctctacggcaagatggtcaggtacccgctcgaggtgctcgcc
atctttgacatcgtgctcatggacctcgtcgcgcgcatcgagcccctcttcgagaagcac
atccagaccaggatctacaacctcaagtcctcggtttgcttgaggaatctcaacccttct
gatatcgagaagatggtgtccatcaagggtatgataattcggtgcagctcggtgattcca
gagctcaaggaggctgtgttccgctgcttggtttgcgggttctactctgagcctgtaatg
gttgatcgagggagggttactgagccgcacatctgtcagaaagaacaatgtaaagctaca
aactctatgactcttgtgcataaccgatgcaggtttgcagataagcagatcataaagttg
caggaaacaccagatgagataccagaaggtggcactccacatactgttagtgtcttgatg
cacgataagcttgtagatgctggaaagcctggagacagggttgagataactgggatatac
agagccatgagtattagagttggcccaactcagaggacagtgaagtcgattttcaagacg
tacattgattgccttcacataaagaagacagacaagtctagacttcatgttgaggactcc
atggaaactgataaccccaatgctaacaagacaactgaagatgattttctcagagataag
gttgagaaattaaaagagttgtcaaagttgccagatatatatgacagattaactaggtca
ttggctccaaacatatgggagctggacgacgttaaaaggggcctcctttgccagcttttt
ggtggaaatgctttgaggcttccttctggagctagtttccgaggcgacatcaatattttg
cttgttggtgatcctggaacaagtaaatcccagcttctccaatacatgcacaaactgtct
cctcgtggcatttatacaagtggcagaggaagttcagctgttggccttactgcatacgtt
accaaggatcctgaaactggtgaaactgttcttgagagtggagcgcttgttttgagtgac
aaaggtgtttgttgtattgatgaatttgataagatgtctgataatgctcgaagcatgtta
catgaggtgatggaacaacagactgtctccattgccaaggctggaataattgcatcttta
aatgccagaacatcagttctagcatgtgcaaatcctactgaatcacgttataatccaagg
ctctctgtgattgacaatatccatcttcctccaacactgctttctaggtttgacctcatt
tatctgatattggacaaggcagatgagcaaactgatagacgcctggctaagcatattgtt
tcgttgcattttgagaatccaaacatagaggagctcgaggtcttggatttgccaacactt
gtagcctacataagttatgcaaggaagcatatacaaccacagttatctgatgaagctgca
gaagaattgactcgcggctatgttgagatgaggaaaagaggaaacagccctggtagcaga
aagaaggtcataactgcgacagctcgacaaattgagagcttgattcggctcagtgaagca
ctggcccgaatgcgattctctgaaatggttgaagtacaagatgttgtagaggccttcagg
cttctcgaagttgccatgcagcaatcggcaactgatcatgccactggtacaatcgatatg
gatcttatcatgactggaatatctgcgagcgaaaggcagaggcgggacaatctcgttgca
gcaacccgcaaccttgtgatggagaaaatgcagcttggagggccctcagtgcgaatgatt
gagttgctggaagaaattaggaagcagagctctatggaagttcatctgcatgatcttcgc
ggtgctcttggcactctgatgacagagggtgccgtagtcatccatggagacagcgtcaag
agggtctga

DBGET integrated database retrieval system