KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275709
Entry
107275709         CDS       T01015                                 
Name
(RefSeq) protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1-like
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    107275709
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107275709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275709
   03400 DNA repair and recombination proteins [BR:osa03400]
    107275709
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    107275709
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107275709
SSDB
Motif
Pfam: AAA MIT Vps4_C RuvB_N AAA_lid_3 AAA_5 AAA_16 DUF815 TIP49 AAA_2 AAA_14 AAA_22 AAA_33 AAA_17 AAA_18 RNA_helicase AAA_24 AAA_25 Parvo_NS1 bpMoxR Mg_chelatase IstB_IS21 AAA_7 DUF5906 Torsin Zeta_toxin
Other DBs
NCBI-GeneID: 107275709
NCBI-ProteinID: XP_015642485
UniProt: B9EZF4
LinkDB
Position
1:complement(2226207..2229871)
AA seq 478 aa
MYSNFKEQAIEYVKQAVQEDNGGNYVKAFPLYMNALEYFKTHLKYEKDPKIKDAIAAKFT
EYLRRAEEIRAVLDGHIGGGGGGGDSEQAKPRGMLRSAIVAAKPSVKWSDVAGLESAKEA
LQEAAILPIKFPHFFTGKRSPWKAFLLYGPPGTGKSYLAEAVATEVDSTFFSISSSDLVS
KWMGESEKLVANLFQMARENAPSIIFIDEIDSLCGQRGECNENEASRRIKTELLVQMQGF
DNSNDKVLVLAATNMPHVLDQAMRRRFDKCIYIPLPDLKARKDTFKIHIGDTPHSLTEGD
FVSLAYQTEGFSGSDIAVCVKDALFQPVRKTQDAKFFIKADDDTWTPSEQSQPGSIQTTM
QELASKGLAAKILLPPISKIDFDEVLVRQRPTVSKKDLVVYEKFTQEFSEEEIFISPLSN
EKPQSHDVPFKKSEEEILTMQKKTKSEEEILTMQKKTKSPMRNFLNVWAKACCCASTI
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtacagcaacttcaaggagcaggcgatcgagtacgtgaagcaggcggtgcaggaggac
aatggcggcaactacgtcaaggcgttcccgctctacatgaacgccctcgagtacttcaag
acccacctcaagtacgagaaggaccccaagatcaaggacgccatcgccgccaagttcacc
gagtacctccgccgcgccgaggagatccgcgcggtcctcgatgggcacatcggcggcggc
ggcggcggcggcgactccgagcaggccaagccgaggggcatgctcaggtcggccatcgtc
gccgcgaagccgagcgtcaagtggagcgacgtcgccggcttggagagcgccaaggaggca
ctgcaagaggccgccatattgcctatcaagtttccacacttctttacaggcaagcgaagc
ccatggaaagcttttcttttgtatggtccaccaggaactggaaagtcttatttggctgaa
gctgttgcaaccgaggttgattcaacattcttcagcatatcttcatcagaccttgtttca
aaatggatgggagaaagtgagaaactagttgctaatcttttccagatggcccgtgaaaat
gctccctccattatcttcatcgatgaaatcgattctttatgcggccaacgtggagaatgt
aatgaaaatgaagcttcccggagaatcaagactgaacttcttgtgcaaatgcagggtttc
gataatagcaatgataaagttctggttcttgctgctacaaatatgccacatgttctggac
caggctatgcggcgacggtttgacaaatgtatctacattcccctacctgacttgaaggca
aggaaagacacttttaagatccacattggggacacaccacatagcttaactgaaggtgat
tttgtgagcttggcctatcaaacagaggggttttctggctcagatattgctgtttgtgtg
aaggatgcgttatttcaacctgtgaggaaaacacaggatgccaagttcttcatcaaggca
gacgatgacacgtggacgccaagtgaacagagtcagcctggttccatacaaaccaccatg
caggaactcgcatcaaaaggtttggctgccaagattcttcttccaccaatctcaaagata
gatttcgatgaagtcctcgtgaggcagagaccaacggtgagcaagaaagatctagtggtg
tatgagaagttcacacaagagttcagtgaggaggagatatttatttcccctctatctaat
gaaaaaccacaatctcatgatgttcctttcaaaaaaagtgaggaggagatattgacaatg
cagaaaaaaacgaaaagtgaggaggagatattgacgatgcaaaagaaaacgaaatcccct
atgaggaattttcttaatgtgtgggctaaagcatgctgttgtgccagtacaatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325480
Entry
4325480           CDS       T01015                                 
Name
(RefSeq) protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4325480
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4325480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4325480
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325480
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4325480
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    4325480
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 RuvB_N AAA_16 AAA_5 AAA_2 AAA_22 AAA_14 DUF815 TIP49 AAA_33 RNA_helicase IstB_IS21 AAA_18 AAA_24 AAA_17 AAA_25 Mg_chelatase AAA_7 Parvo_NS1 PhoH bpMoxR Torsin
Other DBs
NCBI-GeneID: 4325480
NCBI-ProteinID: XP_015621369
UniProt: A2ZP36
LinkDB
Position
1:complement(2215643..2222831)
AA seq 433 aa
MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT
EYLRRAEEIRAVLDEGGGGGGANGGDAAVATRPKTKGKDGEGGGDDSEQSKLRAGLNSAI
ITEKPNIKWNDVAGLESAKQALQEAVILPVKFPQFFTGKRRPWRAFLLYGPPGTGKSYLA
KAVATEADSTFFSISSSDLVSKWMGESEKLVANLFQMARENAPSIIFIDEIDSLCGQRGE
GNESEASRRIKTELLVQMQGVGHNDDKVLVLAATNTPYALDQAVRRRFDKRIYIPLPDLK
ARQHMFKVHLGDTPHNLNESDFENLARRTDGFSGSDIAVCVKDVLFEPVRKTQDAMFFFK
ADGDMWMPCGPKQSGAVQTTMQELASKGLAAKILPPPISRTDFEKVLARQRPTVSKKDLE
VHERFTKEFGEEG
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtacagcaacttcaaggagcaggcgatcgagtacgtgaagcaggcggtgcaggaggac
aatgccggcaactacgtcaaggcgttcccgctctacatgaacgcgctcgagtacttcaag
acccacctcaagtacgagaagaaccctaagatcaaggaggccatcaccgccaagttcacc
gagtacctccgccgcgccgaggagatccgcgcggtcctcgatgaggggggtgggggtggt
ggcgccaacggcggcgacgcggccgtcgccacgcggcccaagaccaagggtaaggatggg
gaggggggtggggatgattccgagcagtccaagctgagggctggactcaactccgccatc
atcaccgagaagcccaacatcaagtggaacgatgtcgccggcctcgagagcgccaagcaa
gcgctgcaggaggccgtcatattgcctgtcaagttcccgcagttctttacgggtaaacgg
agaccatggagggcttttcttttgtatggtccaccaggaacaggaaagtcttatttggct
aaagctgttgcaactgaggctgattctacatttttcagtatatcttcatcagaccttgtt
tcaaaatggatgggagagagtgaaaaacttgttgcaaaccttttccaaatggctcgagaa
aacgctccttccattatcttcattgatgaaattgattcattgtgtggtcaacgaggagaa
ggaaatgagagtgaagcttctaggagaatcaaaactgaacttcttgtgcaaatgcagggt
gttggccataatgatgacaaagtactggttcttgctgctacaaacacgccatatgctcta
gaccaggctgtgcgccggcgctttgataaacgtatttacattccactacccgacctgaaa
gcaaggcaacatatgtttaaggtccatctcggggatacaccacacaacttaaatgaaagt
gattttgagaacttggctcgtcgaacagacgggttttctggttcggatattgctgtttgt
gtaaaggatgtgttatttgaacctgtccgcaaaacacaggatgccatgttcttctttaag
gctgatggtgatatgtggatgccttgtggaccaaagcaatctggtgccgtacaaacaacc
atgcaggagctcgcatccaagggccttgcagcaaagatccttccaccaccaatctcaagg
acagatttcgagaaagtcctcgccaggcagagaccgacagtgagcaagaaagacttggag
gtgcacgaaaggtttacaaaagaatttggcgaggagggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328374
Entry
4328374           CDS       T01015                                 
Name
(RefSeq) protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4328374
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4328374
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328374
   03400 DNA repair and recombination proteins [BR:osa03400]
    4328374
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4328374
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    4328374
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 RuvB_N AAA_5 AAA_16 AAA_2 TIP49 AAA_22 AAA_14 DUF815 AAA_33 AAA_17 AAA_18 AAA_24 RNA_helicase IstB_IS21 NACHT AAA_25 KCNQC3-Ank-G_bd AAA_7 Mg_chelatase Parvo_NS1 bpMoxR PhoH
Other DBs
NCBI-GeneID: 4328374
NCBI-ProteinID: XP_015626832
UniProt: A0A0N7KEQ8
LinkDB
Position
2:3234192..3237667
AA seq 433 aa
MDGGMKEQGILLVRKAVEEDDAGNHARALPLYVHALDYLAAHLKYERNPRVRDAITAKLA
GYIARAEEIRDALLPAAGDDATPPAAAAEEGKAKCGGGEDESDRAKLRAGLHSAIVSEKP
NVRWSDVSGLDGAKQALQEAVVLPVEFPQFFTGKRKPWKAFLLYGPPGTGKSYLAKAVAT
EADSTFFSISSSDLLSKWMGESEKLVTNLFQMARENAPSIIFIDEIDSLCGQRGEGNESE
ASRRVKTEFLVQMQGVGHNDDKVLVLAATNTPYALDQAVRRRFDKRIYIPLPDLKARQHM
FKVHLGDTPHSLTKGDFESLARRTDGFSGSDIAVCVKDVLFEPVRKTQDAMFFFGTAEGD
GDGGAWTPCGPTRPGAVQITMQELAAKGLAAQITPPPITRTDLDKVLARQKATVSEKDLE
VYTRFTREFGEEG
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggacggcggcatgaaggagcaggggatactcctggtgcggaaggcggtggaggaggac
gacgccggcaaccacgcgcgggcgctgccgctgtacgtgcacgcgctcgactacctcgcc
gcgcacctcaagtacgagcggaaccccagggtccgcgacgccatcactgccaagctcgcc
ggctacatcgcccgcgccgaggagatccgcgacgcgctcctccccgccgccggcgacgac
gccacgccgcctgcggcagcggcggaggagggcaaggcgaagtgcggcggcggggaagac
gagtcggatcgggccaagctgcgggcggggctccactcggcgatcgtctcggagaagccc
aacgtgaggtggagcgacgtctccgggctggatggagcaaagcaggcgctgcaggaggcc
gtcgtgctccccgtcgagttcccgcagttcttcaccggcaagcggaagccatggaaagcc
ttcctcctgtacgggccaccggggacgggcaaatcttacttggccaaagccgtcgcgaca
gaggccgattccacattcttcagtatatcttcgtcggatcttctctccaagtggatggga
gaaagtgagaagctggtgacgaacctgttccagatggcccgtgaaaatgcaccctccatt
atcttcatcgatgagatcgactctctgtgtggccaacgaggggaaggcaacgagagcgag
gcttctcggagagttaagacagaattcctcgtgcagatgcagggtgttggacataacgat
gataaagtccttgttcttgctgccacaaacactccatatgctctggatcaggctgtacgg
cggcgttttgacaaacgtatctacattccgctacccgaccttaaagctaggcagcacatg
ttcaaggtccatctgggtgacacccctcacagcctcaccaagggcgacttcgagagcttg
gctcgccggaccgacggcttctccggctccgacatcgccgtctgcgtgaaggacgtgttg
ttcgagccggtgcgcaagacgcaggatgccatgttcttcttcgggacggcggagggcgac
ggcgacggcggcgcgtggacgccgtgtgggccgacgcggccgggcgccgtgcagatcacc
atgcaggagctcgcggccaaaggcctggctgctcagatcacgccgccgccgatcacgagg
acggacttggacaaggtgctggcgaggcagaaggcgacggtgagcgagaaggatctggag
gtgtacaccaggttcaccagagagtttggcgaggaaggctag

DBGET integrated database retrieval system