KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275720
Entry
107275720         CDS       T01015                                 
Name
(RefSeq) probable pectate lyase 4
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107275720
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     107275720
SSDB
Motif
Pfam: Pectate_lyase_4 Beta_helix NosD
Other DBs
NCBI-GeneID: 107275720
NCBI-ProteinID: XP_015649689
UniProt: Q6Z9K9
LinkDB
Position
8:11310680..11312142
AA seq 384 aa
MANRNVPMLLPLAVLFLLGSGGVATAANVIDRCWRGQRNWAADRQRLAVCSVGFAGKMRQ
NRGAGVVAYTVTDPSDDPVRPRPGTLRYGATVLPAKVWITFARDMRIRLAQPLYVKNFTT
IDGRGADVHVAGGAGIVLYHARDVIVHGLHVHDCRAQPPGRVVVPGGAVQPSGSGDGDAI
RLVASSKVWIDHNTLSRCEDGLLDVTVGSTDVTVSNNWFHDHDKVMLLGHDDGFTTDRRM
RVTVAFNRFGPNVNQRMPRIRHGYAHVVNNLYDGWRDYAIGGSMGPSVKSQGNLFAASGG
AGDNKKVTRRMPAVARGGGGGGKDQWHLHSVGDAFENGAFFRQVGNRVRPNYNRHQAFSA
ASAGDVRALTGGVGALTCSATAAC
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggccaaccgcaatgtaccaatgcttctgcccctcgccgtcctcttcctcctcggcagc
ggcggcgtcgccaccgccgcgaacgtgatcgaccggtgctggcgcggccagcgcaactgg
gccgccgaccggcagcgtctggccgtgtgctcggtgggcttcgccggcaagatgcggcag
aaccgcggcgccggcgtggtcgcctacacggtcaccgacccgagcgacgaccccgtccgg
ccgcggcccggcacgctccggtacggcgcgacggtgctgccggcgaaggtgtggatcacc
ttcgcgcgcgacatgcgcatcaggctggcccagccgctgtacgtcaagaacttcaccacc
atcgacggccgcggcgccgacgtgcacgtcgccggcggggccggcatcgtgctgtaccac
gcgagggacgtgatcgtccacggcctccacgtgcacgactgccgcgcgcagccgccggga
cgggtggtcgtcccgggtggcgccgtgcagccctccggcagcggcgacggcgacgccatc
cgcctggtggcgagctccaaggtgtggatcgaccacaacacgctgtcccgctgcgaggac
ggcctgctcgacgtcacggtcggctccaccgacgtcaccgtctccaacaactggttccac
gaccacgacaaggtgatgctcctcggccacgacgacggcttcaccaccgaccgccgcatg
cgcgtcaccgtcgccttcaaccgcttcggcccaaacgtcaaccagcgcatgccaaggata
aggcacgggtacgcgcacgtggtgaacaacctgtacgatgggtggagggactacgccatt
ggagggagcatggggccgagcgtgaagagccagggcaacctgttcgcggcgtcgggcggc
gccggcgacaacaagaaggtgacgaggaggatgccggccgtggcgcgcggcggcggcggc
ggcgggaaggatcagtggcacttgcactcggtcggcgacgccttcgagaacggcgcgttc
ttccggcaggtgggcaacagggtgcggcccaactacaatcggcaccaggccttctcggcg
gcgagcgccggcgacgtaagggcgctcaccggcggcgtcggcgctctcacgtgctctgcc
acggcggcgtgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276207
Entry
107276207         CDS       T01015                                 
Name
(RefSeq) putative pectate lyase 21
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107276207
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     107276207
SSDB
Motif
Pfam: Pectate_lyase_4 Beta_helix Ribonuclease_3 Hexapep_loop
Other DBs
NCBI-GeneID: 107276207
NCBI-ProteinID: XP_015639730
LinkDB
Position
1:35889803..35892141
AA seq 368 aa
MEPPQLDGQCGGEPPASVEGVVFMPYATADSSLRVMAGQAEGFGRHAIGGLHGDVYHVTT
LEDDGDGSLREGCRRREPLWIVFDVSGTIHLSTGLRVSSYKTIDGRGQRVTLSGKGLQLR
ECEHVIVCNLEVEGCRGHDADAVAVKPGSRHVWIDRCGLRGCGDGLLDVTRGSTDVTVSR
CRFSAHDKAVLIGGSAGHVEDRAIRVTIHHCLFDGTRQRHPRVRFGRVHLYNNYTRGWGI
YAVCASVESQIVSQCNIYEAGEKKKVFKYMIEQAADRDQSSTGFIRSEGDLFLNGAEECT
AQDSEAAADELWDFKIQELDFYQSCSVQPASMALKELLECFTGWQPVPLPEDTCLEEETD
SAPADTTA
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggagcctcctcaactcgacggccagtgcgggggcgagccaccggcatccgtggaggga
gtcgtgttcatgccgtacgccaccgcggactcctcgctgcgcgtcatggccggtcaggcc
gagggcttcggccgccacgccatcggcggcctccacggcgacgtctaccacgtcacgacc
ctcgaggacgacggggacgggtcgctccgggagggttgccggaggcgcgagccgctatgg
atcgtcttcgacgtgtcgggcaccatccacctctcgacgggactgcgcgtgtcgtcgtac
aagaccatcgacggccgcgggcagcgtgtgacactgtccggcaaggggctccagctgcgg
gagtgcgagcatgtgatcgtctgcaacctggaggtggaagggtgccgcggccacgacgcc
gacgccgtggcggtgaagcccgggtcgcggcacgtgtggatcgaccggtgcggcctccgc
ggctgcggcgacggcctcctcgacgtcacccggggcagcacggacgtgaccgtgtccagg
tgccgcttctcggcgcacgacaaggccgtgctgatcggcggcagcgccggccacgtcgag
gaccgtgccatccgggtgaccatccaccactgcctcttcgacggcacgcggcagaggcac
ccgcgcgtccgcttcggcagggtgcacctctacaacaactacaccaggggctggggcatt
tacgctgtctgcgccagtgtcgagtcacagattgtatcccagtgcaacatttacgaggca
ggggagaagaagaaagtcttcaagtacatgatagaacaggcggcagacagagaccagagt
tcaactgggttcatccggtctgaaggcgacctgttcctgaacggtgcagaggagtgcact
gctcaggattcagaagctgcggcagatgagctgtgggacttcaagattcaggaattggat
ttctaccagtcttgttccgttcagccggcgtcaatggcgctcaaggagctactggagtgc
ttcaccggctggcagccagttccgctgccggaagacacttgcctcgaagaggaaactgat
tctgctcctgctgacactactgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326883
Entry
4326883           CDS       T01015                                 
Name
(RefSeq) putative pectate lyase 21
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4326883
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4326883
SSDB
Motif
Pfam: Pectate_lyase_4 Beta_helix
Other DBs
NCBI-GeneID: 4326883
NCBI-ProteinID: XP_015618887
UniProt: A0A0P0V431 Q8RYR4
LinkDB
Position
1:complement(20317863..20319607)
AA seq 364 aa
MGASCSSPFPPPPSPAESNAPSASAMHHPPHPAAGGGGPVMPYADADRTLRALAGAAEGF
GRRAIGGLHGPLYRVTSLDDDGHGTLRQACRAHGPLWIVFDVSGDIHLRTYLRVTSHKTI
DGRGQRVRLLGKGLQLKECRHVIVCNLQIEGGRGHDVDAIQIKPSSADIWIDRCSLADCD
DGLVDITRGSTDVTVSRCRFSRHDKTMLVGADPSHTGDRGIRVTVHHCFFDGTRQRHPRV
RFGRAHLYNNYTRGWGIYAVAAGVEAQVASQCNVYEAGAERKAVFRYVPERAADREEAEA
GWVRSEGDAFLNGARPCLVDGGDAAVFRPEEYYERWTMEAASPALKEVVQLCAGWQPVPR
PPGE
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgggcgcctcctgctcctcccccttcccccctcctccttcacctgccgaatccaacgcc
ccctccgcctccgcgatgcaccacccgcctcaccccgcggccggaggaggaggacccgtc
atgccgtacgccgacgccgaccgcaccctccgcgcgctggccggcgcggcggagggcttc
ggccgccgcgccatcggcgggctccacggcccgctctaccgcgtcacctccctcgacgac
gacggccacggcaccctccgccaggcgtgccgcgcccacggcccgctctggatcgtcttc
gacgtctccggcgacatccacctccgcacctacctccgcgtcacctcccacaagaccatc
gacgggcgcggccagcgcgtgcgcctcctgggcaaggggctccagctcaaggagtgccgc
cacgtgatcgtctgcaacctccagatcgagggcgggcgcggccacgacgtggacgccatc
cagatcaagccctcctccgccgacatctggatcgaccgctgcagcctcgccgactgcgac
gacggcctcgtggacatcacccgcgggagcaccgacgtcaccgtctcccggtgccgcttc
tcccgccacgacaagaccatgctggtgggcgccgacccgtcccacaccggcgaccgcggc
atccgcgtcaccgtccaccactgcttcttcgacggcacgcggcagcgccacccgcgggtg
cggttcgggagggcgcacctgtacaacaactacacgagggggtggggcatctacgcggtg
gccgccggggtggaggcgcaggtggcgtcgcagtgcaacgtgtacgaggccggggcggag
aggaaggcggtgttcaggtacgtgccggagagggcggcggaccgggaggaggcggaggcc
gggtgggtgaggtcggagggggacgccttcctcaacggggcgcggccgtgcctggtggac
ggcggcgacgcggcggtgttcaggccggaggagtactacgagaggtggaccatggaggcg
gcgtcgccggcgctcaaggaggtggtgcagctgtgcgccgggtggcagcccgtgccgagg
ccaccgggcgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328714
Entry
4328714           CDS       T01015                                 
Name
(RefSeq) pectate lyase
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4328714
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4328714
SSDB
Motif
Pfam: Pectate_lyase_4 Pec_lyase_N Beta_helix
Other DBs
NCBI-GeneID: 4328714
NCBI-ProteinID: XP_015625737
UniProt: Q6H8B0 A0A0P0VGE6
LinkDB
Position
2:complement(6399410..6402206)
AA seq 446 aa
MDDQRLQWRKPGSFLLVAGVFLAAAAAVSNAGIGEFDEHWEKRRAAAEAAAEEVYKPDPF
NVTNEFNHAVIRSTERGVLRRELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARC
AMGFGRGATGGVRGKIYVVTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQE
LLVASDKTIDGRGAQVHIARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGP
RTRADGDGISLFAATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGAS
DSYPQDKVMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQ
GNRYIAPPNIAAKLITRHYAPEWEWKNWAWRSDGDLFMNGAYFQASNGAINRKVKGSDMV
KPKPGSYVRRLTRFAGALSCRPGEPC
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggatgaccagaggctccagtggaggaagcccggctccttcctcctcgtcgccggcgtg
ttcctggcggcggcggccgctgtgtcgaacgccggcataggcgagttcgacgagcattgg
gagaagcgcagggcggcggcggaggcggcggcggaggaggtgtacaaaccggaccccttc
aatgtcaccaacgagttcaaccacgctgtcatcagatcgacggagcgcggcgttctccgg
cgagagttgagtgggaagaacagcaagtacaaggggccgtgcctggcgacgaacccgatc
gaccggtgctggcgctgccgcaaggactgggccaccgaccggaagcggctcgcccggtgc
gccatgggcttcggccgcggcgccaccggcggcgtccgcggcaagatctacgtcgtcacc
gaccccggcgacggcgacgccgccaacccgcgctacggcacgctccggtggggcgccatg
caggcggcgccgctgtggatcaccttcgccaagtccatggtgatccgcctcacgcaggag
ctcctcgtcgccagcgacaagaccatcgacggccgcggcgcgcaggtgcacatcgcgcgc
ggcggcgccgggatcaccgtccagttcgcccgcaacgtgatcatcaccagcctccacgtc
cacgacgtgaagcacagcgacggcggcgcggtccgcgactcgccgacgcacatcggcccc
cgcacgcgggccgacggcgacggcatctcgctcttcgccgccaccgacgtgtgggtggac
cacgtctccatgtccatgtgcgaggacgggctcatcgacgtcgtgcagggctcgacgggg
gtgaccatctccaacagccacttcaccaaccacaacgacgtcatgctgttcggcgccagc
gactcgtacccgcaggataaggtgatgcagatcaccgtggcgttcaaccacttcggccgt
gggctcgtgcagcggatgccgcgatgccggtgggggttcttccacgtcgtcaacaacgac
tacacgcactggctcatgtacgccatcggcggcggcatgagccctaccatcctcagccag
ggcaaccgatacatcgcccctcccaacatcgccgccaaactgatcacgaggcactatgcg
ccggagtgggagtggaagaactgggcgtggcgctcggacggagacctgttcatgaacggc
gcctacttccaggcgtccaacggcgccatcaacaggaaggtgaagggctccgacatggtt
aagcccaagccaggctcctacgtcaggaggctcacacgcttcgccggcgcgctctcctgc
cggcccggcgagccgtgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335013
Entry
4335013           CDS       T01015                                 
Name
(RefSeq) probable pectate lyase 8
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4335013
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4335013
SSDB
Motif
Pfam: Pectate_lyase_4 Beta_helix NosD
Other DBs
NCBI-GeneID: 4335013
NCBI-ProteinID: XP_015634113
LinkDB
Position
4:2480437..2485897
AA seq 473 aa
MAEAAARRWAAALVLLVLLTGTVELIGGGGGSGGRRLLAGLRAGSTAAASGTRRWLRDSS
WPATAAAAAAASRGDDGDGDEASSAAMTVPGAVDDPEEVVSQVHMSIRNSTARRKLGYLS
CGTGNPIDDCWRCDPDWHKNRQRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPKKG
TLRYAVIRDEPLWIVFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQYVTNVI
IHGLHIHDCRPTGNAMVRSSPSHYGWRTMADGDAVSIFGASHIWVDHCSLSNCADGLIDA
IMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYF
HVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSE
GDLLLNGAFFTPSGAGASASYSRASSLGAKSSSMVGTITSGAGALSCRGGSAC
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcggaggcggcggcgaggaggtgggcggcggcgctggtgctgctggtgcttctcacc
ggcaccgtcgagctcatcggcggcggaggcgggagcggcgggcggcggcttctcgctggc
ctccgggccgggagcacggcggcggcgagcggcacgcggcggtggctgcgcgactcgtcc
tggccggcgacggcggcggccgcggcggcggcgagcagaggagatgacggtgatggcgat
gaggcgtcgtcggcggcgatgacggtgcccggcgcggtggacgacccggaggaggtggtc
tcgcaagtgcacatgtcgatcaggaacagcacggcgaggaggaagctgggctacctgtcg
tgcggcaccggcaatccgatcgacgactgctggaggtgcgacccggactggcacaagaat
cgccagcggctcgccgactgcggcatcggcttcggccgcaacgccatcggcggccgcgac
ggcaagatctacgtggtcaccgaccccagcgacgacgacgcggtgaaccccaagaagggc
acgctccggtacgccgtcatccgcgacgagccgctgtggatcgtcttcaagcgcgacatg
gtgatcacgctcaagcaggagctgatcatgaacagcttcaagaccatcgacggccgtggc
gccaacgtgcacatcgccaatggcgcctgcatcaccatccagtacgtcaccaacgtcatc
atccatggcctgcacatccatgactgcaggcccaccggcaatgccatggtccggagctcg
cccagccactacgggtggcgcaccatggccgacggcgacgccgtctccatcttcggcgcc
agccacatctgggttgaccattgctcgctctccaactgcgccgacggcctcatcgacgcc
atcatgggttccactgcaatcacagtgtccaacaactacttcacccaccacaatgaggtg
atgctcctgggtcacagcgattcctatgtcaaggacaaggcaatgcaggtcacgatagca
ttcaaccatttcggagaaggtcttattcagagaatgccaaggtgcaggcatggttacttc
catgtggtgaacaatgactacacccactgggagatgtacgcaattggtggaagtgctgag
ccaaccatcaacagccagggcaaccgctaccttgctccgacaaatccctttgccaaggag
gttacaaagagggttgagactgctcagaccatctggaagggctggaactggagatcagag
ggggatctcctcctgaacggcgccttcttcaccccatcaggtgcaggcgcctcggccagc
tactcgcgcgcctcaagcctcggtgccaagtcatcatccatggttggcaccatcacatcc
ggtgcgggcgccttgtcgtgccgcgggggctcagcctgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338309
Entry
4338309           CDS       T01015                                 
Name
(RefSeq) pectate lyase
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4338309
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4338309
SSDB
Motif
Pfam: Pectate_lyase_4 Beta_helix Gyro_capsid
Other DBs
NCBI-GeneID: 4338309
NCBI-ProteinID: XP_015638870
UniProt: B9FK32 Q0DJF3
LinkDB
Position
5:complement(12933093..12938362)
AA seq 373 aa
MAAIFIFIWLFASVLSISSASSPLLINGSTADAAPDCGTGNPIDDCWRCDPGWADNRQRL
ADCAVGFGRRAVGGKGGRVYVVNDTGDDAARPAPGTLRYGLVQDEPLWIVFAGDMTISPA
HELVVSSRKTVDGRGARVVVGDGGACFAVRGASDVVIHGLTIRRCRPAPKLEAGMSDGDG
VHNSSDVWVDHCTVEACADGLIDVVVGSTRVTLSNNLLRNHDKAILLGHNDDYTDDKAMQ
VTVAFNRFGPGLVQRMPRCRFGLFHVINNDYIAWQKYAIGGSASPTIISHGNRFYADMAK
EVTKRDDDVPESVWHHWNWVSDGDLMLNGAFFRASGEARTDNLKAPSFARSAPSVPSMTS
SAGALSCKEGSHC
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggctgccatcttcatattcatatggttgttcgcctccgttttatccatttcatcagct
tcttctcctttgctgatcaatggtagtactgctgatgctgcaccggactgcggtaccggc
aacccgatcgacgactgctggcgttgcgaccccggctgggccgacaaccggcagcggctc
gccgactgcgccgtcgggttcggccgccgcgccgtcggcgggaaggggggcagggtgtat
gtcgtgaacgacaccggcgacgacgcagcccgcccggcacccggcacgctccggtacggc
ctcgtccaggacgagcccctctggatcgtgttcgccggcgacatgaccatcagccccgcc
cacgagctggtcgttagctcgcgcaagaccgtggacggcaggggcgcccgcgtggtggtt
ggcgacggcggcgcgtgcttcgcggtgaggggcgcgagcgacgtcgtcatccacgggctt
accatacgccggtgcaggccggcacccaagctggaggccggcatgtcggacggcgacggc
gtccacaactcgagcgacgtgtgggtcgaccactgcacggtggaggcctgcgccgacggg
ctgatcgacgtggtcgtaggttccacccgcgtgacgctttccaacaacctcctgcgcaac
catgacaaggcaattctcctcggccacaacgacgactacaccgacgacaaggccatgcag
gtcaccgttgccttcaatcgctttggaccaggcctcgtccaaagaatgccaaggtgtcgg
tttggtcttttccacgtcatcaacaacgattacatagcatggcaaaagtacgccattggg
ggcagtgcttcaccgaccataattagccacggcaacagattctatgctgatatggccaaa
gaggtgacgaagcgcgatgacgatgtgccggagagcgtgtggcaccactggaactgggta
tccgacggcgacctgatgctcaacggcgcgttcttcagggcatcaggcgaagcaaggaca
gataatttgaaagcccctagctttgcaaggtctgccccctccgtgccgtcgatgacttcc
tcggcaggcgccctctcctgcaaggagggctcgcactgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340099
Entry
4340099           CDS       T01015                                 
Name
(RefSeq) pectate lyase
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4340099
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4340099
SSDB
Motif
Pfam: Pectate_lyase_4 Pec_lyase_N Beta_helix DUF2505
Other DBs
NCBI-GeneID: 4340099
NCBI-ProteinID: XP_015642576
UniProt: Q0DEM8 A0A0P0WSR5
LinkDB
Position
6:complement(2336431..2338207)
AA seq 450 aa
MDIYTTSHHSTIMAASSVTGSRRLCILFYLLTVVATVVTAASAHTAHNATADEEYWEKRA
EEARSFNRAAYVSDPVATLNRFNADVLRATTRRSLARYTGPCMATNPIDRCWRCRDDWAT
DRKRLARCVRGFGHRTVGGAAGKIYVVTDASDDEMVIPRKGTLRYGVIQDRPMWIVFARD
MIIQLRQELIVNHNKTIDGRGAQVHITGAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDS
KRHYGLRTRSDGDGISIMSSSNIWIDHVSMSNCSDGLIDAVSGSTAITISNGHFTKHDHV
MLFGASNSDAQDEVMQITVAFNHFGKGLVPRCRFGFFHVVNNDYTHWLMYAIGGNMNPTI
ISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQNERSYDQ
LDFIPAKHGKYVGQLTKFAGTLNCHVGMPC
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggatatatatacgacatcacatcacagcacaataatggcagcctcctccgtcacgggg
agccgccgcctctgcattctcttctacctcctcactgtcgtcgccaccgtggtcaccgcg
gcgtcggcgcacacggcgcacaacgccaccgccgacgaggagtactgggagaagcgcgcc
gaggaggcccgctcgttcaaccgcgccgcctacgtgagcgaccccgtcgccaccctgaac
cgcttcaacgccgacgtgctccgcgccaccacgcgccgctcgctggccaggtacaccggc
ccgtgcatggcgaccaaccccatcgaccgctgctggcgctgccgcgacgactgggccacc
gaccggaagcggctggcgcggtgcgtccgtgggttcggccacaggaccgtcggcggcgcc
gctggcaagatctacgtggtgaccgacgccagcgacgacgagatggtcatcccgaggaaa
gggacgctccggtacggcgtgatccaggaccggccgatgtggatcgtgttcgcgcgcgac
atgatcatccagctccggcaggagctgatcgtgaaccacaacaagaccatcgacggccgt
ggcgcgcaggtgcacatcaccggcgcccagatcacgctccagggcgtccagcatgtgatc
atccacaacgtccacatccaccactcggtgccgcacggcggcggcatgatccgcgactcc
aagcgccactacggcctccgcacgcgcagcgacggcgacggcatctccatcatgtcctcc
tccaacatctggatcgaccacgtctccatgtccaactgctccgacggcctcatcgacgcc
gtcagcggctccaccgccatcaccatctccaacggccacttcaccaagcacgaccacgtc
atgctcttcggcgccagcaacagcgacgcccaggacgaggtgatgcagatcaccgtggcg
ttcaaccacttcggcaagggccttgtgccgcgctgcaggttcggattcttccacgtcgtc
aacaacgactacacgcactggctcatgtacgccatcggtggcaacatgaacccgacgatc
atcagccaggggaacaggttcatcgcgcccgacgacttgaacgccaaggaggtgaccaag
agggagtacacgccgtacgacgagtacaaggagtgggtgtggaagtcgcagggcgacgtg
atgatgaacggcgccttctttaacgagtccggcggccagaacgagcgcagctacgaccag
ctcgacttcatccctgccaagcacggcaagtacgtcggccagctcaccaagttcgccggc
acgctcaactgccacgtcggcatgccatgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340103
Entry
4340103           CDS       T01015                                 
Name
(RefSeq) pectate lyase
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4340103
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4340103
SSDB
Motif
Pfam: Pectate_lyase_4 Pec_lyase_N Beta_helix
Other DBs
NCBI-GeneID: 4340103
NCBI-ProteinID: XP_015644282
UniProt: B7EHZ9
LinkDB
Position
6:2372992..2374785
AA seq 448 aa
MAGSVVTRSPLCSILFYVLATAAAATATATLVGNITADEEYWAKRSEVARSFNRAAYVSD
PVAVLNRFNEDVLNTTTATAAAARRSLMRRYRRRGPCTVTNPIDLCWRCRKNWASRRKRL
AKCAMGFGHKATGGLAGKIYIVTDAGDEHLVIPRRGTLRHAVIQERPLWIVFARSMVIRL
AKELIVTSDKTIDGRGAQVHVTGAQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFG
IRGESDGDGISVMGSSNIWIDHVSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGA
RDDSPKDKIMQVTLAFNHFGKGLVQRMPRCRFGFFHMVNNDYTHWLMYAIGGNMNPTIIS
QGNRFRASDDMKLKEVTKREYTSYDEYKEWVWKSQDDLFLNGAFFNESGGRNERRYNRLD
LIQARNGRYVGRMTRFAGTLPCRVGKKC
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggcgggctccgtcgtgacgaggagcccactgtgctccatcctcttctacgtcctcgcc
acggccgccgcggcgacggcgacggcgacgcttgtgggcaacatcaccgccgacgaggag
tactgggccaagcgctccgaggtggcgcgctcgttcaaccgcgccgcctacgtcagcgac
cccgtcgccgtgctgaacaggttcaacgaggacgtgctgaataccacgacggcgacggcg
gcggcggcgcggcggtcgctgatgaggaggtaccggcgtcgtggcccgtgcacggtgacg
aacccgatcgacctgtgctggcgctgccgcaagaactgggcgagccgtcgcaagcggctg
gccaagtgcgccatggggttcggccacaaggccaccggcgggctcgccggcaagatctac
atcgtgacggacgccggcgacgagcacctcgtcatccctcggcggggcacgctccggcac
gccgtgatccaggagcggccgctgtggatcgtcttcgcgcggagcatggtgatcaggctc
gccaaggagctcatcgtcaccagcgacaagaccatcgacggccgcggcgcgcaggtgcac
gtcaccggcgcgcagatcacggtgcaggcggtgagcaacgtcatcatccacaacctccac
atccacaactccgtgccgcgctccggcggcctcatccgcgactccatgcaccacttcggc
atccgcggcgagagcgacggcgacggcatctccgtcatgggctccagcaacatctggatc
gaccacgtctccatgtccaactgctccgacggcctcatcgacatcaccgacggctccacc
gccatcaccatctccaactcccacttcaccaagcacgatcacgtgatgctgttcggtgca
cgcgacgactcgccgaaggacaagatcatgcaggtaacgctggcattcaaccactttggc
aaggggctcgtgcagaggatgccgaggtgcaggtttggattcttccacatggtgaacaac
gactacacgcactggctcatgtacgccatcggcggcaacatgaacccgacgatcatcagc
caggggaacaggttcagggcaagcgacgacatgaagctcaaggaggtgaccaagagggag
tacacgagctacgacgagtacaaggagtgggtgtggaagtcgcaggacgacctcttcctc
aacggcgccttcttcaacgagtccggcggccggaacgagcgccggtacaaccggctcgac
ctcatccaggccaggaacggccgctacgtcggccggatgaccaggttcgccggcacgctg
ccatgccgtgtcggcaagaaatgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340105
Entry
4340105           CDS       T01015                                 
Name
(RefSeq) pectate lyase
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4340105
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4340105
SSDB
Motif
Pfam: Pectate_lyase_4 Pec_lyase_N Beta_helix DUF2505
Other DBs
NCBI-GeneID: 4340105
NCBI-ProteinID: XP_015642201
LinkDB
Position
6:2377652..2379279
AA seq 470 aa
MTPVPRRKRPSCTRRIWNSSRDCNARAKERPPPSRGPAASAFSSTSSPSSPWSPRLRRGG
VLGEEAHNATADEEYWEKRAEEARSFNRAAYVSDPVATLNRFNADVLRATTRRSLARYTG
PCMATNPIDRCWRCRDDWATDRKRLARCVRGFGHRTVGGAAGKIYVVTDASDDEMVIPRK
GTLRYGVIQDRPMWIVFARDMIIQLRQELIVNHNKTIDGRGAQVHITGAQITLQGVQHVI
IHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDHVSMSNCSDGLIDA
VSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITVAFNHFGKGLVPRCRFGFFHVV
NNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWKSQGDV
MMNGAFFNESGGQNERSYDQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgacccctgtgccaagaagaaaaagacctagctgtaccagaaggatctggaacagctcg
agagactgcaatgcaagagcgaaagagaggccgcctccgtcacggggacccgccgcctct
gcattctcttctacctcctcaccgtcgtcgccgtggtcaccgcggcttcggcgaggaggc
gtactgggagaggaggcgcacaacgccaccgccgacgaggagtactgggagaagcgcgcc
gaggaggcccgctcgttcaaccgcgccgcctacgtgagcgaccccgtcgccaccctgaac
cgcttcaacgccgacgtgctccgcgccaccacgcgccgctcgctggccaggtacaccggc
ccgtgcatggcgaccaaccccatcgaccgctgctggcgctgccgcgacgactgggccacc
gaccggaagcggctggcgcggtgcgtccgtgggttcggccacaggaccgtcggcggcgcc
gctggcaagatctacgtggtgaccgacgccagcgacgacgagatggtcatcccgaggaaa
gggacgctccggtacggcgtgatccaggaccggccgatgtggatcgtgttcgcgcgcgac
atgatcatccagctccggcaggagctgatcgtgaaccacaacaagaccatcgacggccgt
ggcgcgcaggtgcacatcaccggcgcccagatcacgctccagggcgtccagcatgtgatc
atccacaacgtccacatccaccactcggtgccgcacggcggcggcatgatccgcgactcc
aagcgccactacggcctccgcacgcgcagcgacggcgacggcatctccatcatgtcctcc
tccaacatctggatcgaccacgtctccatgtccaactgctccgacggcctcatcgacgcc
gtcagcggctccaccgccatcaccatctccaacggccacttcaccaagcacgaccacgtc
atgctcttcggcgccagcaacagcgacgcccaggacgaggtgatgcagatcaccgtggcg
ttcaaccacttcggcaagggccttgtgccgcgctgcaggttcggattcttccacgtcgtc
aacaacgactacacgcactggctcatgtacgccatcggtggcaacatgaacccgacgatc
atcagccaggggaacaggttcatcgcgcccgacgacttgaacgccaaggaggtgaccaag
agggagtacacgccgtacgacgagtacaaggagtgggtgtggaagtcgcagggcgacgtg
atgatgaacggcgccttctttaacgagtccggcggccagaacgagcgcagctacgaccag
ctcgacttcatccctgccaagcacggcaagtacgtcggccagctcaccaagttcgccggc
acgctcaactgccacgtcggcatgccatgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341389
Entry
4341389           CDS       T01015                                 
Name
(RefSeq) pectate lyase
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4341389
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     4341389
SSDB
Motif
Pfam: Pectate_lyase_4 Pec_lyase_N Beta_helix Cu-oxidase_2
Other DBs
NCBI-GeneID: 4341389
NCBI-ProteinID: XP_015641991
UniProt: Q5VP91 A0A0P0WY87
LinkDB
Position
6:22821032..22823348
AA seq 448 aa
MEVLIRWSKLPAAGSLVLYAVFLLLSAAATSEANIGEYDEYWQKRKLMADAAAEATYKRD
PFEVTNSFNRAVHRSEEESGRRELAMTKRKKFAGPCKATNPIDRCWRCRADWVTDRKRLA
RCAQGFGRNTTGGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDMIINLK
EEMMINSDKTIDGRGAQVRITNGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDSPEHFG
FRTQSDGDGISIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGS
SDSFSEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIIS
QGNRYIAPPNLAAKRITKQLGATEEEWKNWVWHSEEDLFMEGAYFTTSGGPIQKQFSNKD
LIKPKPGSYVTRLTRFAGSIPCVAGKPC
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggaggtgctgatccggtggagcaagctgccggcggccggctccttggtgctgtacgcc
gtcttcttattgctgtcggcggcagccacatcggaggccaacatcggggagtacgatgag
tactggcagaagcgcaagctcatggctgatgccgccgccgaggctacctacaagcgtgac
cccttcgaggtcaccaacagcttcaaccgcgccgtccacagatcggaggaggagagcggg
aggagggagctggcgatgacgaagaggaagaagttcgcggggccgtgcaaggcgacgaac
ccgatcgaccggtgctggaggtgccgcgccgactgggtgacggacaggaagcggctggcg
cggtgcgcgcaggggttcggccggaacaccaccggagggctggccgggaagttctacctg
gtgacggacggcaccgacgacgacgtggagaacccgcgcccggggacgctccggtggggt
gtcatccaggacgagccactgtggatcatcttcgccaaggacatgatcatcaacctcaag
gaggagatgatgatcaacagcgacaagacgatcgacgggcggggagcgcaggtgcggatc
accaatggcgcgcaggtgacggtgcagaactccaacaacgtgatcatccacaacatccac
atccacgacatcttgcaaggcaagggcgggatgatccgcgactcgccggagcacttcggc
ttccgcacccagtccgacggcgacggcatcagcatcttcggctccaccaacgtctggctc
gaccacctctccctctccaactgccaggacggcctcatcgacgtcatcgccaagtccacc
ggagtcaccatctccaactgccacctcaccaaccacaacgacgtcatgctcttcggctcc
agcgactccttcagcgaggaccagatcatgcagatcaccgtcgctttcaaccacttcggc
cgcggcctcgtccaaagaatgcccagatgccgatggggatttttccacgtggtgaacaac
gactacacgcactggctcatgtatgccatcggagggagcaagaacccgacgatcatcagc
caggggaacaggtacatcgcgccgccaaacctagcggcgaagcggatcacgaagcagctc
ggggcgacggaggaggagtggaagaactgggtgtggcactctgaggaggacctgttcatg
gagggggcctacttcaccacgtccggtggcccgatccagaagcagttcagcaacaaggat
ctgatcaagcccaagcccggatcctacgtcacgaggctcacccgcttcgctggctccatc
ccatgcgtggccggcaagccgtgctag

DBGET integrated database retrieval system