KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275738
Entry
107275738         CDS       T01015                                 
Name
(RefSeq) chaperonin 60 subunit beta 4, chloroplastic-like
  KO
K04077  chaperonin GroEL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107275738
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    107275738
   03110 Chaperones and folding catalysts [BR:osa03110]
    107275738
   03029 Mitochondrial biogenesis [BR:osa03029]
    107275738
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107275738
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     107275738
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   107275738
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    107275738
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107275738
  Exosomal proteins of other body fluids (saliva and urine)
   107275738
  Exosomal proteins of breast cancer cells
   107275738
  Exosomal proteins of colorectal cancer cells
   107275738
  Exosomal proteins of bladder cancer cells
   107275738
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 107275738
NCBI-ProteinID: XP_015633894
UniProt: A0A0P0WAW0
LinkDB
Position
4:complement(22118296..22122544)
AA seq 588 aa
MSRMAAPPPPLSGTGKPPTLPFSLKKPPPMPVYKDLHFNRDLSATKKLQAGVDLVARLVG
VTLGPKGRNVVLSNKYGPPKIVNDGETVLKEIELEDPLENLGVKLVRQAGARTNDVAGDG
CTTSIILAQGLIAEGMKVLAAGINPVQIARGIEKTASALVSELRLMSREIEDHEIAHVAA
VSAGDDYAVGNMISDAFKRVGRKGMVRIENGRGTENGLEIVEGMQFERGYLSPYFVTDCT
NMSAEFTDCKILLVDKKITDASEIIRILDSAVKEDYPLLIVAEDVEEKAMADLIKNKLKG
TIKVAAIKAPSFGEQMTQCLDDIAIMTGGTLVREDMGYTLEKAGKEVLGSASKVVVGKDS
TLIVTDGSTQHVIEKRVAQIKGQIENSSERYQKKILGERIARLCGGIAIIQVGAQTIIEM
KDKKLRIEDALNATKAAIEEGVVIGGGCSLLRLSMKIDRIKESLDNMEQKIGADIFKQAL
SYPTALIANNAGVNGSFVIEKVLLNEDSRYGYNAAKNRYEDLMAAGILDPSKVVRCCIEH
AAVVAKSFLTSDVVIVEAKEGKPVRIRPPMPPKSLIPPMPASASGIRV
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcgaggatggcggcgccgccgccgccgctctccggcaccggcaagccgcccacactc
cccttctccctcaagaagccgccgcccatgccggtgtacaaggacctgcacttcaaccgc
gacctctccgccaccaagaagctgcaggccggcgtggacctggtggcacggctggtcggg
gtgacgctggggcccaaggggaggaacgtggtgctgagcaacaagtacggccctcccaag
atcgtcaacgatggggagacggtcctcaaggagattgaattggaggacccgttggaaaat
cttggagtgaagctggtcagacaggctggtgccaggacgaacgatgttgctggtgatggt
tgtaccacttccataatccttgctcaaggcctcatcgctgaaggaatgaaggtgcttgca
gctggaattaatcctgtccagattgcgcggggcattgagaagactgcttctgctttggtg
tctgaactcagattgatgtcccgggagatagaagaccatgaaattgcacatgtggctgca
gttagtgcaggagatgattatgctgttggaaatatgatttctgatgcttttaaaagagta
ggcaggaaaggcatggtgaggattgaaaatggaaggggcacggaaaatggtctagagatt
gtggaaggaatgcaatttgaacgtggttacctctcaccgtactttgtgactgattgtaca
aatatgtccgcggagtttactgactgtaagatattgttggttgacaagaaaattactgat
gcaagtgagattataaggatattggatagtgctgtcaaagaagattatccattgttgata
gttgccgaggatgtggaagaaaaagcaatggctgatttgataaaaaacaagctaaaaggg
acaattaaagtggctgcaatcaaggccccttcctttggggaacaaatgactcaatgtttg
gatgacattgccatcatgacaggaggtacactagtgcgtgaagacatgggatatacacta
gaaaaggcagggaaagaggttctaggttctgcttctaaggttgtagtcgggaaagactca
acactaattgttaccgatggaagcacccaacatgtgatcgagaaaagggttgctcagata
aagggccaaattgagaactcaagtgagaggtaccagaagaagatattgggtgagagaata
gcaaggttatgtggtggaattgcaatcattcaggtcggtgctcaaacaatcattgagatg
aaagacaagaagctcagaattgaagatgcccttaatgcaacaaaggcagctattgaggaa
ggagttgtgataggtggtggatgtagcctattaagattatccatgaagattgatagaatt
aaggaatcattggataatatggagcagaagattggcgctgacatcttcaaacaggctttg
agttaccctactgcattgattgcaaacaatgctggggtgaacggcagcttcgtcatagaa
aaggtgttattaaatgaggacagtagatatggctacaatgctgccaagaaccgctatgag
gacttaatggccgctggaatattagatccatcaaaggttgtgagatgttgcatagaacat
gctgctgtggtcgccaagtcttttctcacatctgacgtggtgattgttgaggcgaaagaa
ggcaaaccagttcgcataaggcccccgatgcctcctaaaagtttgatacccccaatgcct
gcttctgcttcaggaattcgagtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107279834
Entry
107279834         CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: chaperonin 60 subunit beta 4, chloroplastic-like
  KO
K04077  chaperonin GroEL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107279834
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    107279834
   03110 Chaperones and folding catalysts [BR:osa03110]
    107279834
   03029 Mitochondrial biogenesis [BR:osa03029]
    107279834
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107279834
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     107279834
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   107279834
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    107279834
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107279834
  Exosomal proteins of other body fluids (saliva and urine)
   107279834
  Exosomal proteins of breast cancer cells
   107279834
  Exosomal proteins of colorectal cancer cells
   107279834
  Exosomal proteins of bladder cancer cells
   107279834
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 107279834
NCBI-ProteinID: XP_015620855
LinkDB
Position
Unknown
AA seq 588 aa
MSRIAAPPPPLSGTGKPPTLPFSLKKPPPMPVYKDLHFNRDLSATKKLQAGVDLVARLVG
VTLGPKGRNVVLSNKYGPPKIVNDGETVLKEIELEDPLENLGVKLVRQAGARTNDVAGDG
CTTSIILAQGLIAEGMKVLAAGINPVQIARGIEKTASALVSELRLMSREIEDHEIAHVAA
VSAGDDYAVGNMISDAFKRVGRKGMVRIENGRGTENGLEIVEGMQFERGYLSPYFVTDCT
NMSAEFTDCKILLVDKKITDASEIIRILDSAVKEDYPLLIVAEDVEEKAMADLIKNKLKG
TIKVAAIKAPSFGEQMTQCLDDIAIMTGGTLVREDMGYTLEKAGKEVLGSASKVVVGKDS
TLIVTDGSTQHVIEKRVAQIKGQIENSSERYQKKILGERIARLCGGIAIIQVGAQTIIEM
KDKKLRIEDALNATKAAIEEGVVIGGGCSLLRLSMKIDRIKESLDNMEQKIGADIFKQAL
SYPTALIANNAGVNGSFVIEKVLLNEDSRYGYNAAKNRYEDLMAAGILDPSKVVRCCIEH
AAVVAKSFLTSDVVIVEAKEGKPVRIRPPMPPKSLIPPMPASASGIRV
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcgaggattgcggcgccgccgccgccgctctccggcaccggcaagccgcccacactc
cccttctccctcaagaagccgccgcccatgccggtgtacaaggacctgcacttcaaccgc
gacctctccgccaccaagaagctgcaggccggcgtggacctggtggcacggctggtcggg
gtgacgctggggcccaaggggaggaacgtggtgctgagcaacaagtacggccctcccaag
atcgtcaacgatggggagacggtcctcaaggagattgaattggaggacccgttggaaaat
cttggagtgaagctggtcagacaggctggtgccaggacgaacgatgttgctggtgatggt
tgtaccacttccataatccttgctcaaggcctcatcgctgaaggaatgaaggtgcttgca
gctggaattaatcctgtccagattgcgcggggcattgagaagactgcttctgctttggtg
tctgaactcagattgatgtcccgggagatagaagaccatgaaattgcacatgtggctgca
gttagtgcaggagatgattatgctgttggaaatatgatttctgatgcttttaaaagagta
ggcaggaaaggcatggtgaggattgaaaatggaaggggcacggaaaatggtctagagatt
gtggaaggaatgcaatttgaacgtggttacctctcaccgtactttgtgactgattgtaca
aatatgtccgcggagtttactgactgtaagatattgttggttgacaagaaaattactgat
gcaagtgagattataaggatattggatagtgctgtcaaagaagattatccattgttgata
gttgccgaggatgtggaagaaaaagcaatggctgatttgataaaaaacaagctaaaaggg
acaattaaagtggctgcaatcaaggccccttcctttggggaacaaatgactcaatgtttg
gatgacattgccatcatgacaggaggtacactagtgcgtgaagacatgggatatacacta
gaaaaggcagggaaagaggttctaggttctgcttctaaggttgtagtcgggaaagactca
acactaattgttaccgatggaagcacccaacatgtgatcgagaaaagggttgctcagata
aagggccaaattgagaactcaagtgagaggtaccagaagaagatattgggtgagagaata
gcaaggttatgtggtggaattgcaatcattcaggtcggtgctcaaacaatcattgagatg
aaagacaagaagctcagaattgaagatgcccttaatgcaacaaaggcagctattgaggaa
ggagttgtgataggtggtggatgtagcctattaagattatccatgaagattgatagaatt
aaggaatcattggataatatggagcagaagattggcgctgacatcttcaaacaggctttg
agttaccctactgcattgattgcaaacaatgctggggtgaacggcagcttcgtcatagaa
aaggtgttattaaatgaggacagtagatatggctacaatgctgccaagaaccgctatgag
gacttaatggccgctggaatattagatccatcaaaggttgtgagatgttgcatagaacat
gctgctgtggtcgccaagtcttttctcacatctgacgtggtgattgttgaggcgaaagaa
ggcaaaccagttcgcataaggcccccgatgcctcctaaaagtttgatacccccaatgcct
gcttctgcttcaggaattcgagtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327993
Entry
4327993           CDS       T01015                                 
Name
(RefSeq) ruBisCO large subunit-binding protein subunit beta, chloroplastic
  KO
K04077  chaperonin GroEL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4327993
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4327993
   03110 Chaperones and folding catalysts [BR:osa03110]
    4327993
   03029 Mitochondrial biogenesis [BR:osa03029]
    4327993
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327993
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     4327993
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   4327993
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    4327993
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4327993
  Exosomal proteins of other body fluids (saliva and urine)
   4327993
  Exosomal proteins of breast cancer cells
   4327993
  Exosomal proteins of colorectal cancer cells
   4327993
  Exosomal proteins of bladder cancer cells
   4327993
SSDB
Motif
Pfam: Cpn60_TCP1 FtsA GTP-bdg_M
Other DBs
NCBI-GeneID: 4327993
NCBI-ProteinID: XP_015626534
UniProt: B9F1P3 Q6ZFJ9
LinkDB
Position
2:158612..163713
AA seq 598 aa
MASAFGSTSACGIKITPTAFATKKHLCLVPPPVVSLPRKNRPQRKCNFRVNAAKELYFNK
DGLAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVEN
IGAKLVRQAAAKTNDLAGDGTTTSVVLAQGMITEGVKVVAAGANPVQITRGIEKTAKALV
SELQKMSKEVEDSELADVAAVSAGNNYEIGNMIAEAMNKVGRQGVVTLEEGKSAENNLYV
VEGMQFDRGYISPYFVTDSEKMSVEYENCKLLLVDKKINNARDLITILEDAIRGGYPILI
VTEDIEQEALATLVVNRLRGALKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEVGLSL
DKADRDVLGTAAKVVVTKDSTTIVGDGTTQDEVNKRVTQIKNQIEVAEQEYEKEKLNERI
AKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAI
IETLENDEQKVGAEIVRKSLSYPLKLIAKNAGVNGSVVTEKVLANDNFRYGYNAATGKYE
DLMAAGIIDPTKVVRCCLEHAASVAKTFITSDAVVVDIKEPEKAAAAGNPMGGSGFGF
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggcctcagcattcgggagcacctcagcatgtggcatcaagatcactcctaccgctttt
gccaccaagaaacatctttgcctggttccacccccagtcgtttcacttccccggaaaaat
aggcctcagaggaagtgtaatttcagagtaaatgctgccaaagagttatatttcaacaag
gatgggttggctatcaagaagctgcaaaatggagtcaataagcttgctgatctcgttgga
gtcacccttggtccaaaaggacggaatgttgtccttgagagcaagtatggatcacctaaa
attgtcaatgatggtgttaccgttgcaaaggaggttgagctggaggaccctgttgaaaat
attggagccaaattagtccggcaagctgcagccaagacaaatgatttggctggtgatggg
acaacgacttctgttgtccttgctcaagggatgatcacagagggtgttaaggttgtggct
gctggtgctaatccagtacagattacccgtggtatagagaaaacggccaaagcacttgtg
agtgaactccaaaaaatgtccaaggaggttgaagacagcgaacttgctgatgttgctgcg
gtaagtgctggaaataactacgaaattggcaacatgatagctgaagctatgaacaaggtt
ggacgacagggggtggtcacacttgaagaaggaaagagtgctgaaaataatctctatgtt
gttgagggaatgcaatttgatcgcggctatatttctccctactttgtaactgacagtgaa
aaaatgtcagtggagtatgagaattgcaagttgctccttgtggacaagaaaatcaacaat
gccagagatcttataacaattctggaggatgctattaggggtgggtacccaatcctaata
gttacggaggatattgagcaggaagctcttgcaactcttgtggtcaacaggcttaggggt
gcattgaagattgctgctattaaagctcctggttttggagaacgcaagagtcaatacctt
gatgatattgctactcttactggaggtactgtcatcagggaagaagttggcttgtcccta
gacaaagctgatagagatgttctaggaacggccgccaaggttgtagttaccaaggattca
acaacaatagttggggatggtactacccaggacgaagtaaacaaaagggtgacacaaatc
aagaaccagattgaggttgctgaacaggaatatgagaaagaaaaactgaatgagagaata
gctaagctctctggtggtgttgctgtcatccaggtaggagcacagacagaaactgagctt
aaggaaaagaaactgagggttgaagatgcactgaatgcaaccaaggcggctgttgaggaa
ggtattgttgttggaggtggctgtacgcttttgcggcttgcatcaaaagttgatgccatt
atagaaacacttgagaatgatgaacagaaggttggggctgaaatcgtaaggaagtccttg
agttacccacttaaattaatagcaaaaaatgctggtgttaacggcagtgttgttactgag
aaggtccttgccaatgataacttcaggtatggttacaatgccgctacaggaaaatatgag
gatttgatggctgctggtattattgatcccaccaaggtggtgagatgttgcttggagcat
gctgcgtcggtggcgaaaacattcatcacatcagatgctgttgtggtggacatcaaggag
cctgagaaagcagctgctgctgggaacccaatgggtggatcaggttttggattttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331590
Entry
4331590           CDS       T01015                                 
Name
(RefSeq) chaperonin CPN60-1, mitochondrial
  KO
K04077  chaperonin GroEL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331590
   03110 Chaperones and folding catalysts [BR:osa03110]
    4331590
   03029 Mitochondrial biogenesis [BR:osa03029]
    4331590
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4331590
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     4331590
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   4331590
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    4331590
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4331590
  Exosomal proteins of other body fluids (saliva and urine)
   4331590
  Exosomal proteins of breast cancer cells
   4331590
  Exosomal proteins of colorectal cancer cells
   4331590
  Exosomal proteins of bladder cancer cells
   4331590
SSDB
Motif
Pfam: Cpn60_TCP1 ChlI
Other DBs
NCBI-GeneID: 4331590
NCBI-ProteinID: XP_015632031
UniProt: Q10RW9 B9FB06
LinkDB
Position
3:complement(2401052..2406760)
AA seq 577 aa
MYRAAASLASKARQAGSSARQIGSRLALHRNYAAKDIKFGVEARALMLRGVEELADAVKV
TMGPKGRTVVIEQSFGAPKVTKDGVTVAKSIEFSNRVKNVGASLVKQVANATNDTAGDGT
TCATVLTKAIFAEGCKSVAAGMNAMDLRRGISMAVDEVVTNLKGMARMISTSEEIAQVGT
ISANGEREIGELIAKAMEKVGKEGVITITDGNTLYNELEVVEGMKLDRGYISPYFITNQK
NQKCELDDPLILIHDKKVSNLHAVVKVLELALKKQRPLLIVAEDVESEALGTLIINKLRA
GIKVCAVKAPGFGESRKANLQDLAILTGGEVITEELGMNLENFEPQMLGTCKKVTVSKDD
TVILDGAGDKKAIEERAEQLRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEV
GEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKDLDKLQTANFDQKIGVQIIQNALKT
PVHTIASNAGVEGSVIIGKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAA
SVSSLMTTTESIIVEIPKEEEAAAAAPAMGGMGGMGF
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtaccgcgcggcggccagcctcgcctccaaggcccgtcaagccgggagcagcgctcgt
cagattgggagtaggctcgccttgcatagaaactatgctgccaaggacatcaagtttggt
gtcgaggcccgggccttgatgttgaggggtgttgaggagttggctgatgcggtcaaagtg
acaatgggtcctaagggacgcactgttgttattgagcaaagctttggtgctcctaaagtt
acaaaggatggagttactgttgccaagagcattgaattcagtaacagggttaagaatgtt
ggtgcaagccttgtgaagcaggttgctaatgcgactaacgacactgctggggatgggaca
acatgtgctactgttcttacaaaagctatattcgctgagggatgcaagtctgtagcagct
ggaatgaatgcgatggatttgagacgtggtatctcgatggctgttgatgaagtagtgaca
aatttaaaaggcatggccagaatgattagcacatcagaggaaatagcacaggttggtact
atatcagctaatggggaaagggaaattggtgagctcattgcaaaagctatggagaaggtt
ggcaaagagggagtcatcactattacggatggtaacaccctctacaatgagcttgaagtt
gtagaaggcatgaaacttgacagaggttatatctctccttacttcattaccaaccaaaag
aaccagaaatgtgaactagacgatccactgatcttgatacatgacaagaaagtgtccaac
cttcatgctgtggtgaaagtgttggagttagctctgaagaagcaaaggcctctgcttatt
gttgcagaggatgtagaaagtgaagcattgggtactctgattattaacaagcttcgtgca
ggcattaaggtttgtgcagtcaaagctcctgggtttggggagagcaggaaagccaactta
caggacctcgctatccttactgggggagaagtcataactgaagaacttggaatgaacctt
gagaattttgagcctcagatgctggggacttgcaagaaggttacagtatctaaggatgac
acagtcatccttgatggagctggagataagaaggccattgaagagagagctgagcagctg
agatctgcaattgagctaagcacttctgactatgataaagagaagcttcaggagcggtta
gcaaagctttctggtggtgttgctgttctaaagattggtggagctagtgaagcggaggtt
ggtgagaagaaggatagagtgactgatgcactaaatgctaccaaagctgctgtagaggag
ggtattgtaccaggtggtggagttgcccttctgtatgcatcaaaagacctggataaattg
cagactgcgaactttgaccaaaagattggtgtccagatcattcaaaatgctttgaagacc
ccagtgcacacaattgcttcgaatgcgggtgtagaaggatctgtcattattggcaagctt
ttggaacaggataatactgatctaggttatgatgctgctaaaggtgaatacgttgacatg
gtgaagtctggtatcattgacccactaaaagttatcagaacagctctggtggatgctgca
agtgtgtcctctctaatgactaccacagaatctattattgttgagatccccaaggaagag
gaggcagcagccgcagcacccgcaatgggtggcatgggcgggatgggtttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339466
Entry
4339466           CDS       T01015                                 
Name
(RefSeq) chaperonin CPN60-like 2, mitochondrial
  KO
K04077  chaperonin GroEL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4339466
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4339466
   03110 Chaperones and folding catalysts [BR:osa03110]
    4339466
   03029 Mitochondrial biogenesis [BR:osa03029]
    4339466
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339466
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     4339466
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   4339466
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    4339466
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4339466
  Exosomal proteins of other body fluids (saliva and urine)
   4339466
  Exosomal proteins of breast cancer cells
   4339466
  Exosomal proteins of colorectal cancer cells
   4339466
  Exosomal proteins of bladder cancer cells
   4339466
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 4339466
NCBI-ProteinID: XP_015639320
UniProt: Q0DGC8
LinkDB
Position
5:complement(26835671..26840342)
AA seq 581 aa
MYRAAAAAASSISRSSSALRKQLSRGGCGEQRLWARGYAAKEVAFGVGARAALLQGVNDL
ADAVKVTMGPKGRNVIIERSHRAPKVTKDGVTVAKSIEFEDSAKNVGANLVKQVAEATNK
VAGDGTTCATVLTQAILTEGCKAVAAGVNVMDLRNGINKAISSITTHLKSKAWIINSSEE
INQVATISANGEKEIGDLISKAMEKVGKDGVITITDGKTLDNELEAVQGMKLSRGYISPY
FVTDQKTQKCEMENPLILIHDKKISTMNSLLPVLEMSIKNRRPLLIIAEDVEGEALSMLV
LNKHRAGLKICAVKAPGFGENRRANLDDVAVLTGGEVVSEDQGLDLGKVELQMLGTAKKV
TVSLDDTIILDGGGDKQQIEERCQQLRESMDKSTAVFDKEKAQERLSKLSGGVAVLKIGG
ASEVEVGEKKDRVTDALHAARAAVEEGIVPGGGVALLYATKELDKIITANEDEKIGVQII
KNALKAPLMTIAANAGIDGGVVIGKLIEQDNLNMGYDAARGEYVDMIKAGIIDPVKVIRT
ALQDASSVSLLMTTTEAAVAEPPAAKARMASRMPQMSGMDF
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtaccgggcggcggcggcggcggcgtcgtcgatttcgaggtcctcgtcggcgctgcgg
aagcagctgtcgcgcggcggttgcggggagcagcggctgtgggcgcgggggtatgcggcg
aaggaggtggcgttcggcgtcggagcccgggccgccttgctgcagggcgtgaacgacctc
gccgacgccgtcaaggtcaccatgggccccaaggggcgcaatgtgattatcgagagatcc
catagagctcccaaagtcacaaaggatggagtcacggttgcaaaaagcattgagtttgag
gacagtgctaagaatgttggtgcaaacctggtgaagcaagttgctgaagctactaataag
gtcgcaggagatggtaccacttgtgcaactgtacttacacaggctattcttacggaaggc
tgcaaggctgtggcagcaggggtcaatgttatggacttacgtaatggcataaacaaggcc
ataagttctatcactacacacctcaaaagtaaagcatggattatcaactcctcagaagaa
ataaatcaggtagcaactatttctgcaaatggagaaaaggaaataggagatttgatatca
aaggcgatggaaaaggttggaaaggatggagttattactattactgatggcaagacatta
gacaatgagcttgaagcggtacagggaatgaaactttccagaggctacatatctccttac
tttgtgactgatcagaagactcagaagtgtgagatggaaaatcctcttattctaattcat
gacaagaaaatctcaacgatgaattcacttcttccagttttagaaatgtctatcaagaat
cgtaggcctcttctcatcattgctgaggatgttgagggagaagctctatcaatgcttgtt
ctgaacaagcatcgtgctggattaaagatatgtgctgtcaaagctcctggatttggtgaa
aacagaagagccaatctggatgacgtggctgtgttgacaggaggagaggttgtcagcgag
gaccaaggtcttgatcttggtaaagtcgaactacaaatgcttggcactgctaaaaaggtt
actgtatcccttgatgatactatcattctagatggtggaggcgacaaacagcagatagag
gagaggtgtcaacagcttagagaatcaatggacaaaagcactgctgtatttgacaaagaa
aaggctcaagaacgtctatcaaagttatctggtggtgttgctgtcctcaagattggggga
gctagtgaagttgaagttggtgagaaaaaagatagggtaacagacgctttacatgcagca
agggctgctgtggaggagggcattgtaccaggtggtggagttgcccttctgtatgccacc
aaggagcttgacaagattatcacagcaaatgaggatgaaaagattggagttcaaattatc
aagaatgctttgaaggctcctttgatgactatagctgcaaatgctggcattgatggtggt
gtggtcattgggaagctaattgaacaagataatcttaatatgggctatgatgcagcaaga
ggggagtatgttgacatgattaaggctgggatcatcgaccctgtgaaagtcatccgaaca
gcgctacaagatgcatcaagtgtttctttgctgatgacaacgacagaggcagctgttgct
gagcccccagcagcaaaggccagaatggctagtcggatgccgcagatgagcgggatggat
ttttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339910
Entry
4339910           CDS       T01015                                 
Name
(RefSeq) ruBisCO large subunit-binding protein subunit beta, chloroplastic
  KO
K04077  chaperonin GroEL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4339910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4339910
   03110 Chaperones and folding catalysts [BR:osa03110]
    4339910
   03029 Mitochondrial biogenesis [BR:osa03029]
    4339910
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339910
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     4339910
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   4339910
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    4339910
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4339910
  Exosomal proteins of other body fluids (saliva and urine)
   4339910
  Exosomal proteins of breast cancer cells
   4339910
  Exosomal proteins of colorectal cancer cells
   4339910
  Exosomal proteins of bladder cancer cells
   4339910
SSDB
Motif
Pfam: Cpn60_TCP1 FtsA
Other DBs
NCBI-GeneID: 4339910
NCBI-ProteinID: XP_015642765
UniProt: Q0DF58 Q9LWT6
LinkDB
Position
6:complement(811043..816539)
AA seq 601 aa
MASTFGATSTVGLMAAPTGIVSDKKPSSLSSVSSVSVASRPRNARLQRKCNFRVKAAKEL
YFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELED
PVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVQITRGIEKTA
KALVEELKKLSKEVEDSELADVAAVSAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSEN
NLYVVEGMQFERGYISPYFVTDSEKMSAEYENCKLLLVDKKITNARDLINVLEEAIRGAY
PILIIAEDIEQEALATLVVNKLRGSLKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEV
GLSLDKADKSVLGTAAKVVLNKESTTIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKL
NERIAKLAGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAR
VDAIKDNLENDEQKVGAEIVRRALSYPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAAT
GQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSDVVVVEIKEPEPAPVTNPMDNSGYG
Y
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcttcaacattcggtgccacttctacggttggcctcatggctgcgccaaccggaatt
gtatcagacaagaagccatcttctctatcttcggtgtcatctgtttctgttgccagccga
ccacgcaatgcacgccttcagaggaagtgcaacttcagggtaaaagctgccaaggagttg
tacttcaacaaggatggctcggctatcaagaagcttcagactggagtaaacaagcttgct
gaccttgttggagttacactgggaccaaagggaaggaatgttgttttggagagcaagtat
gggtcccctaggattgtcaatgatggtgttacagttgcaagagaggttgaactggaggat
cctgttgaaaatattggagctaagttggttaggcaagcagcagcaaagaccaatgattta
gctggagatggcacaactacttctgttgtgcttgctcaggggctgattgctgagggtgtt
aaggtcgttgcagctggtgccaatcctgtgcaaattacacgtggtatcgagaaaactgcg
aaagcactagttgaagagctaaagaaattgtcaaaggaggttgaagacagtgagcttgcg
gatgttgctgcagtcagtgctggcaacaattatgaaatcggtaatatgatagcagaggct
atgagcaaggttggcaggaagggtgtggttacccttgaagaagggagaagttctgagaat
aatctctatgttgtggagggaatgcagtttgaacgtggttatatctccccgtattttgta
actgacagcgagaaaatgtctgcagaatatgagaactgcaagcttcttttggtggacaaa
aaaatcaccaacgcaagggatcttatcaatgttttggaggaggccataagaggtgcatac
ccaattctgataattgctgaggatattgagcaggaggctcttgctactcttgttgtcaac
aagcttagagggtcattgaaaattgccgctatcaaagcccctggttttggtgagcgcaag
acccagtacttggatgatattgccattctaactggagcaactgtaatcagggatgaagtt
gggctgtcacttgacaaggcagacaaatcagttttaggaacggctgcaaaggtggtcctt
aacaaagagtcaacaacaattgttggtgatggcagtacacaggaagaagtgactaagagg
gttgcacaaataaaaaatctcatcgaggctgccgaacaagaatacgagaaggaaaagctc
aatgagaggattgcaaagcttgctggtggtgttgcagtcattcaggtgggagcacaaaca
gagaccgaactaaaagagaagaagttgagagttgaggatgccctaaatgctaccaaggct
gctgttgaggaaggtattgttgttggtggagggtgcactcttctgagactggcagctaga
gttgacgccatcaaggacaacctggagaatgatgagcagaaggttggagctgaaattgta
aggagagcgctgagctacccgcttaaattgattgctaagaatgctggtgttaatggaagc
gttgttaccgagaaggttctctctaacgataacttcaagtttggttacaatgctgcaact
ggacagtacgaggatttgatggctgctggtatcattgaccccactaaggtggtgagatgt
tgtcttgagcatgctgcgtcggtggccaagacattcctcacatcggatgtcgtcgtcgtc
gagatcaaggagcctgagcctgcgcccgtcaccaacccgatggacaactccggctacggg
tactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348824
Entry
4348824           CDS       T01015                                 
Name
(RefSeq) chaperonin CPN60-2, mitochondrial
  KO
K04077  chaperonin GroEL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4348824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4348824
   03110 Chaperones and folding catalysts [BR:osa03110]
    4348824
   03029 Mitochondrial biogenesis [BR:osa03029]
    4348824
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348824
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     4348824
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   4348824
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    4348824
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4348824
  Exosomal proteins of other body fluids (saliva and urine)
   4348824
  Exosomal proteins of breast cancer cells
   4348824
  Exosomal proteins of colorectal cancer cells
   4348824
  Exosomal proteins of bladder cancer cells
   4348824
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 4348824
NCBI-ProteinID: XP_015614634
UniProt: Q7G2N7
LinkDB
Position
10:17048047..17053430
AA seq 634 aa
MLLEPPRVFSSLIKSPRPPLFPPPQEKKRLHSSTSSPPPLTSPPLPSLLLPSPRSLLGSA
MYRAAASLASKARQAGSSARQVGSRLALSRNYAAKDIKFGVEARALMLRGVEELADAVKV
TMGPKGRNVVIEQSYGSPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGT
TCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQVGT
ISANGEREIGELIAKAMEKVGKEGVITIADGNTLYNELEVVEGMKLDRGYISPYFVTNPK
TQKCELDDPLILIHDKKVSNLHAVVKVLELALKKQRPLLIVAEDVESEALGTLIINKLRA
GIKVCAVKAPGFGENRKANLQDLAILTGGEVITEELGMNLEKFEPQMLGTCKKVTVSKDD
TVILDGAGDKKSIEERAEQIRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEV
GEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLPTANFDQKIGVQIIQNALKT
PVHTIASNAGVEGAVVVGKLLEQDNTDLGYDAAKGEYVDMVKAGIIDPLKVIRTALVDAA
SVSSLMTTTESIIVEIPKEEKEAPAMGGMGGMDY
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgcttctagagcctcctcgcgtcttctcctctctcatcaaatcccctcgccctcctctc
tttcctcctccccaagaaaaaaaaaggcttcatagctcaacctcctcgccgccgccgctc
acctcccctcccctcccatccctcctcctccctagccccaggtcgctgctcggctccgcc
atgtaccgcgcggccgccagcctcgcctccaaggctcggcaagccgggagcagcgctcgc
caggttggaagcaggcttgccttgagcaggaactatgctgccaaggatatcaagtttgga
gttgaggcccgtgctttgatgctgaggggtgttgaggagttggcagatgcagtcaaagtg
acaatgggtcctaagggacgcaatgtggttattgagcagagctatggttcaccgaaagtc
acaaaggacggtgtgactgttgccaagagcattgagttcaaggatagagtcaagaatgtt
ggtgcaagccttgtaaagcaggttgctaatgcgaccaatgatactgctggagatggtacc
acttgtgctactgtattgactaaagcaatatttactgaggggtgcaagtctgttgctgct
ggcatgaatgcaatggatttaaggcgtggtatttcaatggctgttgatgctgttgtaact
aacctaaagggcatggctagaatgatcagcacatcagaggaaatagctcaggtgggcaca
atatcagcaaatggggaaagggaaattggtgagcttattgcaaaggctatggagaaggtt
ggcaaggagggtgtaatcaccattgcggatggtaacaccctttacaatgagcttgaagtt
gtggaaggcatgaaacttgacagaggctacatctctccttactttgttaccaacccaaag
acccagaaatgtgaactggatgaccccttgatcctgatacatgacaagaaggtttcgaac
ctgcatgcagtagttaaagtcttggagttggctctgaagaagcaaaggcctctgctgatt
gttgctgaagatgtagagagcgaggcattgggtactctgattattaacaagcttcgtgca
ggcatcaaggtctgtgctgttaaagctcctgggtttggggagaacaggaaagcaaactta
caggaccttgcgatccttactggaggagaagtcataactgaagagctaggaatgaatctt
gagaagttcgagcctcagatgttgggtacatgcaagaaggtaactgtatctaaggacgac
actgttattcttgatggagctggagacaagaaatccattgaagagagggctgagcagatt
agatctgcaattgagctaagcacttctgattatgacaaggaaaagctacaggagcggttg
gcaaagctctccggaggtgttgctgttctaaagatcggaggagccagtgaagctgaagtt
ggtgagaagaaggatagagtgacagatgcattgaatgccactaaagctgctgtggaagag
ggtattgtaccaggtggaggtgttgcacttctttatgcatcaaaggagctggataaattg
ccgactgctaactttgatcaaaagattggtgtacaaatcattcagaatgctttgaagaca
ccggtgcacactattgcttccaacgcaggtgtagaaggggctgttgttgtcggtaagctt
ttggaacaagataacaccgaccttggctatgatgcggctaaaggtgaatatgtggacatg
gtgaaggctggtatcattgacccactaaaagtgatcagaactgccttggtggatgctgca
agcgtatcatctctgatgacaaccacggaatccatcatcgtagagatcccaaaggaagag
aaggaggcgccagcgatgggaggcatgggtggaatggattactaa

DBGET integrated database retrieval system