KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275752
Entry
107275752         CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich SC35-like splicing factor SCL30
  KO
K12900  serine/arginine-rich splicing factor 10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107275752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    107275752
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    107275752
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107275752
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    107275752
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 107275752
NCBI-ProteinID: XP_015620444
UniProt: B9GDW0 Q2QNB0
LinkDB
Position
12:complement(23589651..23593529)
AA seq 263 aa
MRRYSPPYRSPPRRGYGGRGRSPPRRGYGGRREQGSGSLLVRNIPLSCRGEDLRVPFERF
GPVRDVYLPKDYYSGEPRGFAFVEFVDPYDASEAQYHMNRQVFFGREITVVLAAESRKRP
EEMRSRARVRGYSGNEGRRSSYYGRSRSRSRSPHYRGRPRSRSYSPAPRRRDDYSASPPR
KDTHPTKSPRRQPKEHDEEKKRRSYSPASRDGDPRDADNGYEKRSPPPDSDGSPPHRRSP
RHSSGSPPGSRSRSADVSPARSD
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaggaggtacagcccaccatatcgcagtccccctaggaggggctatggtggcagagga
agaagtccccctaggaggggatatggaggacggagggagcagggttctggaagtctcttg
gtccgcaacatcccattaagctgcagaggggaggatcttcgagttccttttgaaaggttt
ggtcctgttcgggatgtttacctgccaaaggattattacagcggggaaccacggggattt
gcatttgtggagttcgttgacccttatgatgcctctgaggctcaatatcacatgaatcgc
caggtgtttttcggccgggagataactgttgttcttgctgctgagtcgcggaaaaggcca
gaggaaatgcgcagtagagctagagtcaggggttactctggaaacgaagggcgccgctct
tcatattatgggaggtctcgttcccgttctcgctctccccactatcgaggtcgtccacgg
tcaaggtcatactctcctgctccaagacggcgagatgactactcagcttccccaccgaga
aaggatacgcaccccacaaaatctcctaggcgtcagccaaaagaacatgatgaagagaag
aagcggagatcctactctcctgccagtagagatggcgaccctcgcgatgctgataacggt
tatgagaagaggtcgcccccacctgacagcgatggatcccctccacaccggaggtctcct
aggcactcctcagggtcgcctccaggatcccgctctaggtccgccgatgtttcccctgcc
cgcagcgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324080
Entry
4324080           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich splicing factor RS2Z32
  KO
K12896  serine/arginine-rich splicing factor 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4324080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4324080
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4324080
SSDB
Motif
Pfam: RRM_1 zf-CCHC zf-CCHC_5 RRM_5 zf-CCHC_3 RRM_occluded RRM_3 CLIP1_ZNF
Other DBs
NCBI-GeneID: 4324080
NCBI-ProteinID: XP_015618527
UniProt: A0A0P0UY79 Q5ZCD9
LinkDB
Position
1:complement(2986325..2989305)
AA seq 324 aa
MPRYDDRDRYDDRYGGNTRLYVGRLSSRTRTRDLEDLFGRYGRVRYVDMKHEFAFVEFSD
ARDADEARYNLDGRDFDGSRMIVEFAKGVPRGPGGSREYMGRGPPPGSGRCFNCGIDGHW
ARDCKAGDWKNRCYRCGDRGHIERDCRNSPKNLKRGRSYSRSPSPRRGRSRGRSYSRSRS
RSYSRSQSPRRDSRNERRSRSPRDSRSPRGSPRDSRSPRGSPRDSRSPKGSPRDTQSPRG
SPRDSRSPRRSASPPNGRNRSPTPNASRSPAPRDSRSPMRADSRSPADHERRDMSTAANG
RSPSPRDYEDNGNHRASPRGSASP
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcctcgctatgatgaccgtgatcgctacgatgaccgttacggcggcaacacgaggctg
tacgtaggtcgtctttcctcgcgcacccggacccgggaccttgaagaccttttcggcaga
tatgggagagtgcgatatgtggatatgaagcacgagtttgcatttgttgaatttagtgat
gctcgggatgctgatgaggcaaggtacaacctggatggtcgggactttgatggaagccgc
atgattgttgagtttgctaaaggggttccacgtggccctggaggatcacgtgaatatatg
ggcagaggaccaccacctggttctggccgctgctttaactgtgggattgatgggcactgg
gcccgtgactgcaaagctggagactggaaaaacagatgctatcggtgtggagacaggggc
catatagaaagggactgccggaacagccctaagaatctcaagcgtggaagaagctactca
agatccccatcccctcgtcgtgggaggagccgtggtaggagctacagcaggagccgtagc
aggagctacagccgctcccagtctccaaggagggatagccgtaatgaaaggagatcaagg
agccctcgtgacagtcggagccctaggggaagcccccgtgacagtcgcagccctaggggg
agcccccgtgacagtcgcagccctaaggggagccctcgcgacacccagagccctagggga
agccctcgtgatagccgcagccctaggagaagtgcttcaccacccaacgggaggaaccgc
agccctacccctaatgccagcaggagtcctgcaccaagggacagcaggagcccaatgaga
gctgacagccgtagccctgctgaccatgagcgccgtgacatgagtacagctgccaatggc
cggagcccaagccccagggattatgaagacaatggcaatcatcgggcctcgcctagagga
agcgcatccccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328133
Entry
4328133           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich splicing factor RS41 isoform X1
  KO
K12893  serine/arginine-rich splicing factor 4/5/6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328133
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328133
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4328133
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_5 RNA_bind DDAH_eukar
Other DBs
NCBI-GeneID: 4328133
NCBI-ProteinID: XP_015626894
LinkDB
Position
2:complement(1193399..1197064)
AA seq 286 aa
MMPYFYDQHCTLLCVALSSPVRLQFPTPIQPCQPHGRLETSGGFAFVYMEDERDADEAIH
RLDRIEFGRKGRRLRVEWTKEDRSGGRRGNSKRSPNNTRPTKTLFVINFDPINTRTRDLE
RHFDQYGKISNVRIRRNFAFVQYELQEDATKALEGTNGSTLMDRVISVEYALRDDDEKRN
GYSPERRGRDRSPDRRDYRGRSASPYGRGRERGSPDYGRGRERGSPDYGRGGDRGSPDYH
RGASPQGGNKGDERGSPPNNYDRERREASPGYDRPRSRSPARYERE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgatgccttacttttacgatcagcattgcaccctcctctgcgttgcactctcctccccc
gtccgattacaatttcccacgccaatccaaccatgccaaccacacggccggctggagacg
agtggagggtttgcctttgtctacatggaagatgaacgtgatgctgatgaagctatccat
aggcttgacagaattgaatttggcagaaaagggaggagacttagggttgaatggacaaag
gaggatcgcagtggtggtagaagagggaactcaaagagatctccaaacaatacaaggcca
accaaaactttgtttgtgatcaattttgatccaatcaacacaaggacaagagatctggag
aggcacttcgatcaatatggcaagatctcgaatgtcagaatcagaaggaactttgccttt
gtccagtatgagttacaggaagatgctactaaagcactggagggtacaaatggaagcact
cttatggacagggttatctctgtggaatatgcacttcgtgatgatgatgagaaaaggaat
ggatacagcccagaaagaagaggccgtgatcgatctccagacaggagggactatcgcggg
cggtctgcaagtccttatggcagagggcgtgagaggggcagccctgactatggaagaggc
agggagaggggcagcccggactatggcaggggtggtgacagaggtagccctgattatcac
cgtggtgcaagtccgcaagggggcaacaaaggtgatgagaggggcagcccccctaacaac
tacgaccgtgaacgccgtgaagccagccctggctatgataggccccgcagtcgctcacct
gcgaggtacgagagagaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328900
Entry
4328900           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich SC35-like splicing factor SCL30
  KO
K12900  serine/arginine-rich splicing factor 10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4328900
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328900
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4328900
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4328900
SSDB
Motif
Pfam: RRM_1 RRM_5
Other DBs
NCBI-GeneID: 4328900
NCBI-ProteinID: XP_015626888
UniProt: Q6K542 Q6KA23
LinkDB
Position
2:complement(8553857..8558156)
AA seq 265 aa
MRRYSPPYRSPPRRGYGGRGRSPPRRGYGGRKEQGSGSLLVRNIPLSCRAEDLRVPFERF
GPVRDVYLPKDYYTGEPRGFAFVEFVDPYDASEAQYHMNRQVVFGREITVVLAAESRKRP
EEMRSRARVRGYSDHEGRRSSHYGRSRSRSRSRSPRYRGRPRSRSYSPAPRRRDDYSASP
QRKDTHRAKSPRRQPKEHEVDKKRRSYSPANKDGDRRDADNGYEKRSPPADSDGSPPHRR
SPRQSSGSPPGSRSRSADGSPARSD
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaggaggtatagtccaccttatcgcagtccaccaaggaggggatatggtggcagagga
agaagtccccctaggaggggatatggaggacggaaggaacagggttctggcagtctcctg
gtccgcaacatccctttaagctgcagagcggaggatcttagagttccttttgaaaggttt
ggacctgttcgagatgtttacctgccaaaggattattataccggggaaccgcgagggttt
gcattcgtggagtttgttgacccttatgatgcttctgaggcccaatatcatatgaatcgt
caggtggtttttggccgggagataactgttgttcttgctgctgagtcacggaaaaggcca
gaagagatgcgcagtagagccagagtcagagggtactctgaccatgaaggccgtcgttca
tcccattacgggaggtctcgttcacgttcgcgttcccgctctccccgttatcgtggtcgt
ccacggtcaaggtcatactctcctgctccaagacgacgagatgactattccgcatcccca
cagagaaaagacacacatcgtgcaaaatctcctaggcgtcagccaaaagaacatgaagta
gacaagaagcggagatcctattctcctgccaataaagatggggaccggcgtgatgctgat
aatggttatgaaaagaggtcgccgccagctgacagcgatggatcccctccgcaccggagg
tcccccaggcaatcctcaggatcgcctccaggatcccgctccaggtctgccgacgggtct
cctgcccgcagtgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329951
Entry
4329951           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich splicing factor RSZ23 isoform X2
  KO
K12896  serine/arginine-rich splicing factor 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329951
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4329951
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4329951
SSDB
Motif
Pfam: RRM_1 zf-CCHC RRM_7 zf-CCHC_2
Other DBs
NCBI-GeneID: 4329951
NCBI-ProteinID: XP_015625857
UniProt: Q6K9C3
LinkDB
Position
2:complement(23992515..23996404)
AA seq 200 aa
MARVYVGNLDPRVTAREIEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG
KNGWRVELSTKAGSGRGRDRSGGSDMKCYECGEPGHFARECRLRIGSGGLGSGRRRSRSR
SRSPRYRGRSRSRSPRYRRSPSYGRSPRDRSPKRRSYSRSPPPARARSYSRSPPPPRERS
YSRSPAQPANREESPYANNA
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctcgcgtgtacgtggggaacctggatccgcgcgtgacggcgcgggagatcgaggac
gagttccgcgtgtttggggttctgaggagtgtatgggttgctagaaaaccaccaggtttt
gcctttattgactttgatgaccgcagggatgcagaagatgcaattcgtgatttagatggc
aagaatggatggagggttgagctgtcaaccaaagctggtagtggtcgtggccgagatcgt
tccggtggttctgacatgaagtgctatgaatgtggcgaacctggtcattttgcacgtgaa
tgccgcttacggattggttctggaggccttggcagtggaagacgccgcagccgcagccgt
agccggagtccaaggtaccgcggtcgtagtcgcagccgcagcccaagataccggaggagc
ccaagctatggtagaagcccacgggatcgttctccaaagaggcgcagctacagcaggtcg
ccaccaccagctcgtgcacgaagctacagccgatcacctccacctcctcgtgagcgaagc
tacagcagatcaccagcacagccagccaaccgcgaggagtccccctacgcaaataacgcg
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330968
Entry
4330968           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich splicing factor RSZ21 isoform X1
  KO
K12896  serine/arginine-rich splicing factor 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4330968
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4330968
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4330968
SSDB
Motif
Pfam: RRM_1 zf-CCHC
Other DBs
NCBI-GeneID: 4330968
NCBI-ProteinID: XP_015622565
UniProt: Q6K4N0
LinkDB
Position
2:complement(33541810..33546549)
AA seq 185 aa
MARLYVGNLDPRVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG
KNGWRVELSRNSSSRGGRDRHGGSEMKCYECGETGHFARECRLRIGPGGLGSGKRRSRSR
SRSRSPQYRKSPTYGRRSYSPRDRSPRRRSVSPVRGRSYSRSPRGRGGSPYADGRDGGRY
RRSRS
NT seq 558 nt   +upstreamnt  +downstreamnt
atggcccgcttgtatgttggcaacttggatccccgagtgacttccggggaacttgaagat
gagtttcgtgtgtttggagttctgcgaagtgtctgggttgcccgtaaaccacctggtttt
gcatttatcgattttgatgacaagagggatgctgaggatgcactccgtgatttagatggc
aagaatggatggagagttgagctctcacggaactcaagtagccgcggaggtcgtgatcga
catggtgggtctgagatgaagtgctatgagtgtggtgaaactgggcactttgctcgtgaa
tgtcgtttgcgtattggtcctggaggtctgggtagtggaaagcgtcgtagcaggagtcgc
agccgcagtcgcagccctcaataccgcaagagcccgacctatggtagaagaagctacagt
cctcgtgatcgctctccaaggcgccgcagtgtttcaccagttcgtgggcgcagctacagc
aggtcaccacgtggccgaggtggttctccttatgctgatggaagagatggtggcaggtac
cgccgtagcaggagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332476
Entry
4332476           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich splicing factor RS2Z32
  KO
K12896  serine/arginine-rich splicing factor 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332476
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4332476
SSDB
Motif
Pfam: RRM_1 zf-CCHC zf-CCHC_5 RRM_5 CLIP1_ZNF zf-CCHC_2
Other DBs
NCBI-GeneID: 4332476
NCBI-ProteinID: XP_015630497
UniProt: Q10N19 B9F7Q3
LinkDB
Position
3:complement(9852750..9856056)
AA seq 330 aa
MPRYDDHYGSTRLYVGRLSSRTRSRDLEYLFGRYGRIREVELKRDYAFIEFSDPRDADEA
RYNLDGRDVDGSRILVEFAKGVPRGAAGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA
GDWKNKCYRCGERGHIERNCQNSPRNLRRERSYSRSPSPRRGRGHGRSRSYSRSRSRSYS
RSRSRSLSGSPRGRRDRDDRRSRSLSYSRSPRRSISPAANGKERNPSPNGRRSPRSPQDR
VSPPPKDNDERNGDSPWGRENSRSPSDGYRSPVAANGRSPSPRNNGSPSPMDNNSRSPRD
NGSPSPRDGNGDGGSRGGSRSPRASESPEA
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcctcgctatgatgatcattatggaagcacacgcttgtatgttggtagactgtcttcg
cgcactcgttctcgtgacctagaatatcttttcggcagatatggaagaatacgtgaagtg
gagttgaagcgcgactacgcgtttattgaattcagtgatccccgtgatgctgatgaagcg
cggtataacctagatggcagggatgttgatggaagccgcattcttgttgagtttgctaaa
ggagttccacgtggtgctgctggtggttcacgtgaatatatggggagaggacctcctcca
ggaacaggtcgctgttttaactgtgggattgatggtcactgggcaagagactgcaaggct
ggtgactggaagaacaaatgttaccgttgtggagaaagaggtcacatagaaagaaactgc
caaaacagtccaagaaatctcaggcgagagagaagttattcgcgctccccatcgccacgc
cgtggacgtggtcatggtcgtagtcgtagctatagccggagccggagcaggagttacagc
cgatctaggtccagatccctatctggatctcccaggggacgcagagatcgtgatgatagg
agatcaaggagtcttagctacagcagaagtcccaggcgatccatctccccagcagcaaat
ggaaaggagcgcaaccccagcccgaatggtaggcggagtccaaggagtccacaggatcgg
gtaagcccaccacccaaggataatgatgagcgcaatggtgacagcccctggggcagggag
aacagcaggagcccatctgacggctaccgtagccctgtggctgccaatgggcgcagccca
agcccaaggaacaatggaagccctagtccaatggacaacaatagccgaagcccaagggac
aacggcagcccgagccctagggatggaaatggtgatggtggtagccgtggcggctcacgc
tcgcccagagcaagcgagtcccctgaagcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332806
Entry
4332806           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich-splicing factor SR34
  KO
K12890  serine/arginine-rich splicing factor 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332806
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332806
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4332806
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_7 Nup35_RRM_2 RRM_3
Other DBs
NCBI-GeneID: 4332806
NCBI-ProteinID: XP_015633039
UniProt: Q10LL5 A0A8J8YLK6
LinkDB
Position
3:12814568..12819364
AA seq 286 aa
MSRRWSRTIYVGNLPGDIREREVEDLFYKYGRIVDIDLKIPPRPPGYAFVEFEDPRDAEE
ACAGRDGYNFDGHRLRVEPAHGGRGNGGSSFDRPSNFGGGGRRGVSRHSEYRVLVTGLPS
SASWQDLKDHMRKAGDVCFSEVYREGGGTVGIVDYTNYDDMKYAIKKLDDSEFRNAFSKG
HIRVKEYDGKRARSYSRSRSPSRSRSKSRSLSKSPRTRRSASRSRSRSRSVSSRSRSASK
GRSPSRSPARSKSPNASPANGEASSPKKRSPSRSPSRSRSPDAKSE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagcaggcggtggagccggacgatctacgtggggaatctccctggtgacatcagggag
agggaggtggaggatctcttctacaagtatggccgaattgttgatattgacttgaagatc
cctccgaggccaccaggctatgcttttgtagagtttgaagatcctcgtgatgctgaagaa
gcatgtgctggcagggatggttataactttgatggacatcgtctaagggttgaacctgct
cacggtgggagaggtaatggtggttcctcctttgaccgccccagcaactttggtggtgga
ggacgccgtggtgtgtccaggcactcagaataccgtgttctggttactggtttgccttct
tctgcatcatggcaagatttaaaggaccatatgcgcaaggctggtgatgtttgtttctca
gaagtgtatcgcgagggcggcggtactgtagggattgtggactacacaaactatgatgac
atgaaatatgctataaagaaacttgatgacagtgaattcaggaatgccttttctaaaggt
cacataagggtgaaggaatatgatggcaagcgcgcccgctcctattcacgtagccgaagc
ccaagtcgtagccgaagcaaaagcaggagtctaagtaaatctcctagaactcgccgttca
gcatcccgatctcgatctcgatcaaggtctgtttcttcccgttcacggtcagcatcaaaa
gggcgctctccatcaagatcaccagcaagatccaaatctccaaatgcttctcctgcaaat
ggtgaagcatcaagccccaagaaacggagcccaagcaggagcccatctcgttcacggtct
cctgatgcgaaatctgaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332903
Entry
4332903           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich SC35-like splicing factor SCL28
  KO
K12900  serine/arginine-rich splicing factor 10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332903
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4332903
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332903
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4332903
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4332903
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2
Other DBs
NCBI-GeneID: 4332903
NCBI-ProteinID: XP_015632345
UniProt: Q10L03 Q0DRQ6
LinkDB
Position
3:14176386..14181039
AA seq 243 aa
MAGYRSRSRSYSPQPRRRYSRSPPRYKRYDDPRDRYPRGGGGGGGGGEGPRRGYGRPPAP
TGLLVRNISLTARPEDIRIPFEQFGPVKDVYLPRNFHTRELRGFGFVKFRYPEDAAVAKQ
ELNHQVIGGREISIVFAEENRKTPQEMRMRTRTSGRYMDGSHRRRSVSRSPRSRYHSYSP
SPSPARRDYRDHRDDYSPGESLSPHGQDKRHHRSNGRSASPDELERHVSPSNNGHGPPVD
GKS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggccgggtaccggagccggagccggagctacagcccgcagccgcgccggaggtacagc
cggagccccccgcggtacaagcggtacgatgacccgcgcgaccgctatcctcgcggcgga
ggtggaggtggaggtggaggcgaagggccccgccgcgggtatggccggccgcctgcgccg
accgggctcctcgtccgcaacatctcgctcaccgcaaggcctgaagatattcgtattccg
tttgagcaatttggccctgtaaaggatgtctaccttccaagaaatttccatacaagggaa
ttacgtggctttgggtttgtaaaattccgctatccagaagatgctgcagtggccaagcaa
gaattgaatcatcaagttattggtggacgagagatttcaatagtttttgccgaggagaac
agaaaaaccccacaagaaatgcggatgaggacaagaacaagtggaagatacatggatggt
agccacagaaggcggtcagtatcaagatctccaaggtctcgttaccattcttattcacct
tcaccctctccagctagacgtgactacagggatcaccgtgatgattattcacctggggaa
tcactctctccacatggtcaggacaagcggcaccacagatcaaatggtcgatctgctagc
ccagatgagctcgagcgtcatgtatctccatccaataatggacatggtcctccagttgat
gggaaaagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333005
Entry
4333005           CDS       T01015                                 
Name
(RefSeq) serine/arginine-rich splicing factor SC35 isoform X1
  KO
K12891  serine/arginine-rich splicing factor 2/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4333005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4333005
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   SR proteins
    4333005
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 Nup35_RRM RRM_5
Other DBs
NCBI-GeneID: 4333005
NCBI-ProteinID: XP_015629144
UniProt: Q10KD9
LinkDB
Position
3:complement(15475255..15478292)
AA seq 206 aa
MSRLGRYGPPAVRDSYSLLVLNVSFRTTADDLLALFDRCGEVLDIRIPRDRRTGDSRGFA
FVRYKYEDEAQKAVDKLDGRTVDGRDIMVQFAKYGPNAERIHKGRIVEEISKPRGRSRSP
SPKRRYRADYRDRGYRDDYRDRHYRDDYQDREYRRSRSIERYERERYQEKGYRRRSRSIS
PDYDRRHRKNGRPRDERSPRSRSPLT
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcgcgcctcggccgctacggcccaccggcggtccgcgactcctactccctcctcgtc
ctcaacgtctccttccgcacgacggccgacgacctcctcgcgctcttcgaccgctgcggc
gaggtcctcgacatccgcatcccccgcgaccgcaggactggggattcgagagggttcgcg
ttcgtgaggtacaagtacgaggacgaggcgcagaaggccgtcgataagctcgacgggagg
acggtggatgggagggatatcatggtgcagttcgccaagtacggcccaaatgctgaaaga
attcataaggggaggattgtagaagagatttcgaagccaagaggccgatccagaagtcct
agtccaaaacggaggtatcgtgctgactaccgagacaggggctaccgtgatgactatcgg
gacagacactatcgtgatgactatcaggacagggagtataggagaagccgaagcatagag
aggtatgaacgtgagaggtatcaagaaaaaggctatcgtcgcaggagccggagcattagc
cctgattatgacaggaggcatcgcaagaatggcaggcccagggatgaacgttctccacgc
tctcgaagccctttgacctag

DBGET integrated database retrieval system