KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275757
Entry
107275757         CDS       T01015                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B
  KO
K12666  oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107275757
   00513 Various types of N-glycan biosynthesis
    107275757
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275757
SSDB
Motif
Pfam: Ribophorin_I
Other DBs
NCBI-GeneID: 107275757
NCBI-ProteinID: XP_015636827
UniProt: A0A0P0WGP2
LinkDB
Position
4:complement(35473646..35478034)
AA seq 474 aa
MMAPSLSTAVSSLLLLLLLAAAISVSSSPPMPEDSIRVISAEKRIDLTSPIVKVFLTLKL
ENDATAPEASQVLLAFTPTEVEHLAIVKATRAEGKRKKKIYVPLSVKASDLAAAPNGARL
YSILLSTPLKPAEVTTLEVFYALTHSLEPFPAEITQSDPQLVYYRDSAVLLSPYHVLEQV
TYIKMPSNRVESFTRVDPTSRAGNEVKYGAYNNQLPNSYVPILVHYENNRPFAVVEEFVR
KVEISHWGNVQITEQYKLKHGGAQHKGVFSRLEYQSRPSISGVSSFKNLLARLPPRVHSV
YYRDEIGNISSSHLRSDSHKSELEIEPRYPLFGGWHCTFTIGYGLPLQDFLFESDDGRRY
INLTFGCPLLDTVVDDLTIKVVLPEGSTSPQAVVPFLMEQYLETSYSYLDVVGRTTVVLK
KRNVVGEHNVPFQVYYEFNPIFMLAEPLMLISAVFLFFVACIAYLHMDLSIGKS
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgatggcgccgtccttgtccaccgccgtctcctctcttctcctcctcctcctcctagcc
gctgctatctccgtctcctcctcaccgccgatgccggaggacagcatccgggtcatctcc
gccgagaaaaggatcgacctcaccagccccatagtcaaagttttcctcacactaaagctc
gagaatgatgccactgcccctgaagcatctcaagttctactcgcattcacacccacagag
gttgaacatcttgcgattgtcaaggcgaccagagcggaggggaagcgcaagaagaagata
tatgtgcctctctctgtgaaagcctctgatcttgctgccgctccaaatggtgctcgcctg
tactccattttgctgagcactccattgaaacctgctgaggtgacgacgctggaagtattt
tatgctttgacacactctttggagcccttcccagcagagatcacccagtcagatccccag
ctggtttactaccgtgacagtgctgtgcttctatctccgtaccatgttctggagcaggtt
acctacatcaaaatgccgagcaatagggtggagtcctttacaagggtggaccccaccagt
cgagctggtaatgaagtgaaatacggcgcatacaacaaccagcttccaaactcgtatgtg
cccatacttgtgcattatgaaaataatcgtccgtttgctgttgttgaggaatttgtgcgc
aaggtggagatttctcattgggggaatgtccaaatcactgagcagtataagctgaaacat
ggtggtgctcagcacaaaggagtcttttcaaggcttgagtatcaatccaggccttctata
agtggagtgtcatcatttaagaatcttcttgcaaggttgcctcctcgagttcattcagta
tactatcgtgatgagatcggcaacatatcttcatcccatttgcgtagtgattcgcacaag
tcagaacttgaaattgagcccagatatccattatttggtggttggcactgcacgttcacc
attggctatggtttgccattgcaagattttctctttgaatcagatgatggtcgacgctac
ataaatcttacttttggatgccctctgttggatacggtggtagatgatcttaccatcaaa
gtcgtgcttcctgagggatcgacaagtccacaagctgtagttcctttcctgatggaacaa
tatcttgagactagttattcataccttgatgttgttggaaggacgacagttgtactaaag
aagagaaacgtagttggagagcacaatgttcctttccaggtgtattacgaattcaatccg
atcttcatgctcgcagaaccgttgatgctgatatcagccgtgttcctgttctttgtagcc
tgcattgcttatcttcacatggatctttccattgggaaatcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324876
Entry
4324876           CDS       T01015                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4324876
   00513 Various types of N-glycan biosynthesis
    4324876
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4324876
SSDB
Motif
Pfam: Ribophorin_II Enas
Other DBs
NCBI-GeneID: 4324876
NCBI-ProteinID: XP_015613641
UniProt: Q5N7W3
LinkDB
Position
1:39695969..39703183
AA seq 698 aa
MAAAGGLPASATLLLLVIAAVAVAPLASAVRPVSDAHRSAAAELFAASPDGSFGDLETTY
EAVRTFQILGVEKDKGLIGKACKFAAEKLASSSSSPAKDLFHAARISGVLKCSVDSGVYD
DVATRLKAVIKDTNSLLELYYSVGGLLSIKEQGHNVVLPDADNTFHAIKALSQSDGRWRY
DTNSAESSTFAAGIALEALSAVISLADSEVDSSMIAVVKNDIVKLFDTIKSYDDGTFYFD
EKHVDAAEYKGPITTSASVVRGVTSFAAVASGKLNIPGEKILGLAKFFLGIGLPGSAKDC
FNQIESLSFLENNRVFVPLVLSLPSKVFSLTSKDQLKVEVTTVFGSAAPPLRVNLVQVLG
SDSKVITTETKELQFDLDNNVHYLDIAPLKIDVGKYSLVFEISLQEQEHETIYATGGTNT
EAIFVTGLIKVDKAEIGISDNDAGTVESVQKIDLQKDTSVSLSANHLQKLRLSFQLSTPL
GKTFKPHQVFLKLKHDESKVEHLFVVPGSARQFKIVLDFLGLVEKFYYLSGRYDLELAVG
DAAMENSFLRALGHIELDLPEAPEKAPKPPAQAVDPFSKFGPKKEISHIFRSPEKRPPKE
LSFAFTGLTLLPIVGFLIGLMRLGVNLKNFPSLPAPAAFASLFHAGIGAVLLLYVLFWIK
LDLFTTLKYLSFLGVFLVFVGHRALSYLSSTSAKQKTA
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggccgccgccgggggtctcccagcctcggccaccctcctcctcctcgtcatcgccgcc
gtggccgtcgctcccctcgcctccgccgtccgcccggtttccgacgcccacagatccgct
gccgccgagctcttcgccgcttcccccgacggatccttcggcgatttggagacgacgtat
gaggcggtcaggacgttccagatactcggggtggagaaggacaagggcttgattggtaag
gcgtgcaagttcgccgccgagaagctggcctcctcgtcatcgtcgcccgcgaaggatctg
ttccacgcggcccggatcagcggcgtcctcaagtgcagtgttgattccggagtttacgat
gatgtcgctacgaggcttaaggctgtgatcaaggacactaactcgctgctggaactctac
tattctgtgggagggttgctcagcatcaaggaacaaggccacaatgttgttttacctgat
gcagataacacatttcacgcaattaaggcacttagccaaagtgacggaagatggcgttat
gacactaacagcgctgaatcgagcacgtttgctgctggtatcgcactagaagcattgtct
gcagttatttcactggcagattcggaagttgactcatccatgatagctgtggtgaaaaat
gacattgtgaagctatttgacacgatcaagagctatgatgatgggacattttactttgac
gagaagcatgttgatgctgccgaatacaagggccctataacaacatctgcttcagtagta
aggggtgtcacctcttttgcagctgttgcttctgggaaattgaatatccctggtgagaaa
atactgggtttggcgaagttttttcttggtatagggctaccaggtagcgcaaaggattgc
tttaaccagattgagtcattatcattcttggaaaacaatagggtatttgttcctctggtc
ctttcacttccttccaaagtattttcgctgacctccaaagaccagcttaaggttgaagtc
accacagtatttggatctgctgcacctcctctcagagtgaatcttgtacaagtgctgggc
tctgactctaaggtcatcactactgaaaccaaggaacttcagtttgaccttgataacaat
gttcattacctggatattgctccattgaaaatagatgttgggaagtactcgcttgttttt
gagatttctcttcaggaacaagaacatgaaactatttatgctactggagggacaaatact
gaggcgatctttgtcacaggattgatcaaagttgataaggcagaaatcggaatttctgat
aatgatgctgggactgtggagtctgttcaaaagatagatctgcagaaagatactagtgtt
tctctttctgcaaaccatctgcagaagttgcggttatcttttcaactgagtacaccactc
gggaagacatttaaacctcaccaggtgttcctcaagttaaagcatgatgaaagcaaggtt
gagcatttatttgttgtaccaggctctgcaaggcagtttaaaattgttctagactttctt
ggtttggtggagaaattctactacctttctggaagatatgacctggagcttgcagttggt
gatgctgcaatggagaattcatttctacgagcccttggccatattgaattggacctgcct
gaggccccagaaaaagccccaaagcctccggcccaggctgttgatccattctcaaaattt
ggtccgaagaaggaaatatcgcacatattccgttcaccagagaagaggccacccaaggaa
ctctcatttgcgtttacgggcctcacgcttctgcctattgttgggttcttgattgggctt
atgcgtctcggggtaaacttgaagaacttcccgtccttgccagcacccgcagcatttgcc
tcacttttccatgctggaattggagcagtgctgctgctctacgttctcttctggattaag
ctggatcttttcacaaccctgaagtacctcagcttccttggtgtcttccttgtgtttgtg
ggccatagggctctatcttacctttcctccacgtcagcgaaacagaagactgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333265
Entry
4333265           CDS       T01015                                 
Name
(RefSeq) probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3
  KO
K12669  oligosaccharyltransferase complex subunit gamma
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4333265
   00513 Various types of N-glycan biosynthesis
    4333265
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4333265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4333265
Transporters [BR:osa02000]
 Solute carrier family (SLC)
  SLC58: MagT-like magnesium transporter
   4333265
SSDB
Motif
Pfam: OST3_OST6
Other DBs
NCBI-GeneID: 4333265
NCBI-ProteinID: XP_015632716
UniProt: Q94I55
LinkDB
Position
3:complement(20363577..20370046)
AA seq 336 aa
MESPPHPLLLLLTLLVAAGAASAGADDLVAELQSLRSRSPSGVIHLTDTSITRFLSAPAP
RPYSVLVFFDAASLHSKTDLHLPQLRREFALLSASFLAHNPASADLFFADIEFSESQHSF
AQFGVNSLPHVRLVRPEHTRLAGSEQMDQSHFSRLADSMAEFVESRTGLEVGPIVRPPLV
SRNQMILLVILFLVSIPFLIKRIMDGETLFHDRRVWMAGALFIYFFSVSGGMYGIIRHTP
MFITDRSDPNKLVFFYQGSGMQLGAEGFAVGFLYTLVGLMIAMVTHLLVRVESLQIQRFT
MLAVMIIGWWAVKKVILLDNWKTGYSIHTFWPSSWR
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggagtccccaccccaccccctcctcctccttctcacgctcctcgtcgccgccggcgcc
gcctccgccggcgccgatgacctggtcgccgagctgcaatccctgcggtcccgctccccg
tcgggcgtgatccacctcaccgacacctccatcacccgcttcctatccgccccggcgccg
cgcccctactccgtgctcgtcttcttcgacgccgcctcgctccactccaagaccgacctc
cacctcccccagctccgccgcgagttcgccctcctctccgcctccttcctcgcccacaac
cccgcctccgccgacctcttcttcgccgacatcgagttctcggagtcgcagcactcgttc
gcgcagttcggcgtcaactccctcccccacgtccgcctcgtccgccccgagcacacccgc
ctcgctggctccgagcagatggaccagtcccacttctcccgcctcgccgactccatggcg
gagttcgtggagtcccgcaccggcctcgaggtcggccccatcgtccgcccgcccctcgtc
tcccgcaaccagatgatcctactcgtcatcctcttcttggtctccattccgttcctcatc
aagaggatcatggacggggagaccttgttccatgaccgacgggtttggatggctggggcg
ctgttcatttacttcttcagcgtgtccggggggatgtacgggatcatcaggcacacgccg
atgttcatcaccgaccggtccgatccaaacaagctcgtgttcttctaccaggggtctggg
atgcagctcggcgccgagggttttgcggttgggttcttgtacactctcgtggggctcatg
atcgccatggtgacacacttgctggtgagggtggagagcctgcagatccagcgttttacg
atgctggcggtcatgataattgggtggtgggcagtgaagaaggtgattcttttggataac
tggaagactggatatagcattcataccttctggcccagcagctggaggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335701
Entry
4335701           CDS       T01015                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
  KO
K12668  oligosaccharyltransferase complex subunit epsilon
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4335701
   00513 Various types of N-glycan biosynthesis
    4335701
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4335701
SSDB
Motif
Pfam: DAD DUF6185
Other DBs
NCBI-GeneID: 4335701
NCBI-ProteinID: XP_015635531
UniProt: Q0JDK9
LinkDB
Position
4:19598160..19600828
AA seq 114 aa
MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLS
GVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG
NT seq 345 nt   +upstreamnt  +downstreamnt
atgccgagggccacgagcgatgcgaagcttctaattcagtccctgggcaaggcttatgct
gccacaccaacaaatctcaagatcattgacctctatgtggtctttgcagtcgccactgcc
cttattcaggttgtttacatgggaatagtggggtcatttcctttcaactctttcctttct
ggcgtcctctcatgcataggaactgcagtcctcgctgtttgccttcgtattcaagttaac
aaagataacaaggaattcaaggatcttcctcctgaaagggcgtttgcagatttcgttctg
tgcaatctggtgctccacttggtgatcatgaacttccttggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338348
Entry
4338348           CDS       T01015                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A
  KO
K12666  oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4338348
   00513 Various types of N-glycan biosynthesis
    4338348
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4338348
SSDB
Motif
Pfam: Ribophorin_I TMP_3 Fib_alpha FlgN
Other DBs
NCBI-GeneID: 4338348
NCBI-ProteinID: XP_015640190
UniProt: Q0DJC5
LinkDB
Position
5:13529541..13534295
AA seq 615 aa
MATPPPLRRVAALLLLLVAAASTPTARADLVVTRADRKVDLTSHIVRVLTSLKVENSGPE
AVSQFLLAFPNVQAKNLAAIRAFGTEEKVKGPSMVLPIEVVQPSGVPPELTFFSASLSKP
LEKGKTLHLDVLTVFTHSVQPFPEEITQAESQLVVYQDSAQYLSPYPVKVQTLSIRLPGG
RVESYTKYPNTKLAESELKYGPYEDLPPFSYSPMVVHYENNNPFAVAKEVIREIEISHWG
NVQITEHYNIAHGGAKLKGEFSRIDYQSRPYIRGVSSFRHLIARLPPRAHSIYYRDEIGN
ISTSHLWSDSKKTQLEVEPRFPLFGGWQTTFTIGYGLPLQDFVFNSDGKRFLNITFGSPV
EEILIEKLIVKVVLPEGSKDIDISVPFPTKQEQEVKYSHLDISGRPVVVLEKLDVIPEHN
LYFQVYYRFNNISLLREPMMLITGFFLLFMACIVYMRTDMSISKNSPSYLAKVQWDEVQS
IIQQIQAIFNQCLAAHDKLETSLHELSRSGDVKSCKVARKTADAQFKELAKELKPLLTSL
QSSSQSYQIWPKVEELVAKERELQDKLMTRHSTVVDSFEKKLRGQDVENRIAAQQQKVAA
LRQEVESLLEYISEI
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcgacgccaccgccgctccgccgcgtcgccgccctcctcctcctcctcgtcgccgcc
gcctccacccccaccgcacgggccgatctcgtcgtcaccagggcggatcggaaggttgac
ctgacttcgcacatcgttcgtgtcctcacttcgctcaaggttgagaatagtggaccggag
gctgtttctcaatttctactggcgtttcccaatgtccaagcaaagaacttagcagctata
agagcatttggtactgaggaaaaggtgaaaggtccaagtatggtccttccgattgaagtt
gttcagccttctggagtgcccccagaacttacattcttttcggcatctttatccaaacct
ttggagaaggggaagactcttcacttagatgtcctgaccgtatttacgcactctgtccag
ccattccccgaagaaatcacacaagctgaatcgcagcttgttgtctatcaggacagtgct
cagtatctgtcaccttaccctgttaaggtacagacacttagtatcagattgcctggtgga
agagttgagtcctacacaaagtacccaaacacaaaacttgcagagtcagaactaaaatat
ggaccatatgaagatcttccaccgttttcctactcccctatggttgtgcactatgagaac
aataacccttttgcagttgcaaaggaagttataagggagatagagatatctcactggggg
aatgtacagattacagaacattacaacattgctcatggtggtgccaaactcaagggtgaa
ttttccaggattgattaccaatctagaccgtacataagaggggtctcatcttttaggcat
cttattgctagactgcctccaagggcacattctatatactacagagatgagattggtaac
atttcaacatcacatttatggagtgattccaagaagactcaacttgaagttgagccaagg
tttcctttgtttggtggttggcaaacgacctttaccattggttatggtttacctcttcaa
gactttgttttcaattctgatggaaagagattcctcaatatcacatttggttctccagtg
gaggagattctcatagaaaagcttattgtgaaggttgttctgcctgaaggttcaaaggat
attgatatttcagttccatttccaacaaagcaagagcaagaggtgaagtattcacacctt
gatatttctggaaggccagtggttgtcttggagaagcttgatgttattccagagcataat
ctatatttccaggtttactacaggttcaacaacatctctctactcagagaaccgatgatg
ttgataactggcttctttctcctcttcatggcctgtattgtttacatgcgcactgacatg
tcaatctctaagaattctccttcttatctggcaaaggtgcagtgggatgaggtacagagc
atcatccagcaaatccaggctatcttcaaccaatgtctagcagctcatgataaactggag
acctcattacacgagttatctaggtcaggagatgttaaatcatgcaaagtggctcgtaag
acagctgatgcacagtttaaggaattagcaaaagagttgaagccattgttgacatccctg
cagtcatcctctcagtcttaccagatatggccaaaggtagaggaattggttgccaaggag
agagagttgcaggataagctcatgacaaggcattccactgtggttgacagctttgaaaag
aagttgcgagggcaagatgtggagaacaggattgctgcccagcagcagaaagttgctgcc
ctgaggcaagaggtcgaatctcttttagagtacatcagtgagatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342702
Entry
4342702           CDS       T01015                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
  KO
K12670  oligosaccharyltransferase complex subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4342702
   00513 Various types of N-glycan biosynthesis
    4342702
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4342702
SSDB
Motif
Pfam: DDOST_48kD DUF4350 TIP39
Other DBs
NCBI-GeneID: 4342702
NCBI-ProteinID: XP_015646882
UniProt: Q6ZLK0
LinkDB
Position
7:5885356..5889924
AA seq 439 aa
MAAPRHHHLALAVALALLVVTAAAADEGGPRGRRVLVLVDDLAVRSSHSAFFASLQGRGF
DLDFRLADDPKLSLHRYGQYLYDGLVLFAPSTPRFGGSVDQNSILEFIDAGHDMILAADS
SASDLIRGIATECGVDFDEDPEAMVIDHINYAATDAEGDHTLIAGDDLIQSDVILGSKKI
EAPVLFRGIGHAVNPSNSLVLKVLSASPSAYSANPKSKLASPPSLTGSAISLVSVMQARN
NARVLISGSLDLFSNRFLKSGVQKAGSKIRHEKAGNEQFVTETSKWVFHERGHLKAVNVK
HNKVGETNEPGMYRINDDLEYSVEIYEWSGTSWKPYVADDVQVQFYMMSPYVLKTLSTDK
KGVFSTSFKVPDVYGVFQFKVEYQRLGYTGLSLSKQIPVRPYRHNEYERFITSAYPYYAA
SFSTMGAFFIFSFVYLYHK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcggcgccgcgccaccaccacctcgccctcgccgtcgccctcgccctcctcgtcgtc
accgccgcggcggcggacgaggggggaccgcgggggaggcgggtgctggtgctcgtggac
gacctggcggtgcggtcgtcgcactcggccttcttcgcgtcgctccaggggcgagggttc
gatctcgacttccgcctcgccgacgaccccaagctctcactccaccgctacggccagtac
ctctacgacggcctcgtcctcttcgccccctccaccccgcgttttggaggatcagtggac
caaaattcaattctggaattcatcgatgctggtcatgatatgatcctggcagcagactct
tcggcctctgatcttatccgaggcattgcaacagagtgtggggttgattttgatgaggat
ccagaggcaatggttattgatcacattaattatgctgccactgatgctgaaggtgatcat
actttgattgctggtgatgacctcatccagtcagatgtgatactggggtcaaagaaaatt
gaggcccctgtattatttcggggaattggacatgcggttaatccatctaacagcttggtc
ctgaaagtcttatccgcctctccgtcagcatactcagcaaacccaaagtctaagttggct
tcccctccatctctcacagggtcggctatatcactggtttctgttatgcaggcaagaaac
aatgctcgggtcttgatatctggatcactcgatctgtttagcaacaggttcctaaaatct
ggtgttcagaaggccggtagcaagataaggcatgagaaagctggaaatgaacaatttgtg
acagaaacaagcaaatgggtcttccatgagaggggccatctaaaggcagtgaatgtcaag
cataacaaggttggggagacaaatgagcctggcatgtaccgcatcaatgatgacttggaa
tactctgttgagatctacgaatggtctgggaccagctggaagccgtatgttgctgatgat
gttcaagttcagttttacatgatgagcccttatgttctgaagacactgtcgactgacaag
aagggtgtattttcaacatccttcaaagttccagatgtttatggagttttccagttcaaa
gttgagtaccagaggcttggatatactggtctctctctttctaagcagattccagtgcgc
ccttacaggcataatgagtatgaaagattcataacttcggcatatccgtactatgctgcg
tcgttttcaacaatgggagccttcttcatcttctcatttgtgtacctgtaccacaaatag

DBGET integrated database retrieval system