KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275814
Entry
107275814         CDS       T01015                                 
Name
(RefSeq) probable trehalose-phosphate phosphatase 6
  KO
K01087  trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107275814
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     107275814
SSDB
Motif
Pfam: Trehalose_PPase
Other DBs
NCBI-GeneID: 107275814
NCBI-ProteinID: XP_015650924
UniProt: Q6ZAL2
LinkDB
Position
8:19578759..19582458
AA seq 370 aa
MTKQSVVVPEVAVPMPPNSAPLLPYPPPRAAPGVAVRKKYLQAQLDLGAGLPLINGWVES
MRASSPTHAKAAAALAAAGAVDDERAAWMVRHPSALSKFEQIVAASKGKKIVMFLDYDGT
LSPIVDDPDSAFMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDI
KGPAKASRHNKAKAKGVLFQPASEFLPMIEQVHDSLIERTKCIPGAKVENNKFCVSVHFR
CVDEKSWSTLADIVKAELKDYPKLKLTQGRMVFEIRPTIKWDKGKALEFLLESLGFADCT
NVLPVYIGDDRTDEDAFKVLRKRGQGIGILVSKYPKDTNASYSLQEPAEVMEFLLRLVEW
ERLSRARPKW
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgacgaagcagagcgtggtggtgccggaggtggcggtgccgatgccgcccaactccgcg
ccgctgctcccgtacccgccgccgcgggccgcgccgggcgtcgccgtgcgcaagaagtac
ctccaggcgcagctcgacctcggcgcgggcctcccgctcatcaacggatgggtggagtcc
atgcgggcctcctcccccacccacgccaaggccgccgccgcgctcgccgccgccggcgcc
gtcgacgacgagcgcgccgcctggatggtgaggcacccgtcggcgctgagcaagttcgag
cagatcgtggcggcgtccaaggggaagaagatcgtcatgttcctcgactacgacggcacg
ctgtcccccatcgtcgacgacccggactccgccttcatgtccgacacgatgcggcgggcg
gtgcgcagcgtcgccaagcacttcccgacggcgatcgtcagcggccggtgccgcgacaag
gtgttcgagttcgtgaagctggcggaactctactacgccggtagccatggcatggacatc
aagggccccgcgaaggcctcccgccacaacaaggccaaggcgaaaggcgttctctttcag
ccggctagcgagttcctccccatgatagaacaggtgcacgattctctgatagaaaggacc
aagtgcatacctggagccaaggtggagaacaacaagttctgtgtgtctgtccacttcaga
tgtgtcgatgaaaagagctggagcacattggctgacatagtgaaggcagagctcaaggac
taccccaaactgaagctcacgcaggggaggatggtgttcgagatccggcccaccatcaag
tgggacaagggcaaggccctcgagttcctcctcgagtcgctagggttcgccgactgcacc
aacgtgctgccggtgtacatcggcgacgaccggaccgacgaggacgcgttcaaggtgctc
cgcaagagaggccagggcatcggcatcctcgtgtccaagtaccccaaggacaccaacgcc
tcctactccctgcaggagccagccgaggtgatggagttcttgctgcggctggtggagtgg
gagcgcctctcccgtgctcgccccaagtggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276255
Entry
107276255         CDS       T01015                                 
Name
(RefSeq) probable trehalose-phosphate phosphatase 5 isoform X1
  KO
K01087  trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107276255
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     107276255
SSDB
Motif
Pfam: Trehalose_PPase Hydrolase_3 S6PP Methyltransf_28
Other DBs
NCBI-GeneID: 107276255
NCBI-ProteinID: XP_015634520
LinkDB
Position
4:complement(27725951..27729765)
AA seq 370 aa
MSNGLPLMTNPMIKSQPVLALPSNLMPCLVTSKKHPCSSLCVTYISKRELVEVVDGLVGV
MMTSSNREKPDIESGYDGSSDEDSTENSRAEICPSALCFFDQIVASAQDKKVVLFLDYDG
TLSPIVNDPEKAFMSSEMRATVKSVAKHFPTAIVSGRSRDKVFDFVKLTEIYYAGSHGMD
ILASFADSDSTIEKTKETKLFQPANEFLTMITEVSKSLIEVTKAIKGATVENNKFCVSVH
YRNVDKKNWKLVAQVVNNVLKDFPSLKVSTGRKVLEVRPMINWDKGKAVEFLLRSLELDD
SETVLPIYIGDDKTDEDAFKVLRERKNGCGILVSQVPKKSEAFFMLRGPSEVMEFLSSLV
RWKEQSTFED
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgagcaacggtttgccactcatgaccaatcccatgatcaaaagccagccagtgttggca
ctgccttcaaatctaatgccatgtttggttacatccaagaagcatccatgttcttcattg
tgtgtgacatacatcagtaagcgtgaacttgttgaagtcgttgatggacttgtcggggta
atgatgacatcatcgaaccgtgaaaagccagacattgaatctggttacgacggttcgtct
gatgaagattccactgagaattctcgtgcagaaatttgtccttctgccttatgtttcttc
gaccaaatcgtagctagtgcgcaagacaagaaggttgtgttgtttctagactatgatggc
acactttctcctattgtgaatgatccagagaaagcattcatgtcctctgagatgcgtgct
actgtgaaaagtgttgcaaagcacttccctacagcaatagttagtgggagatcccgcgac
aaggtgtttgattttgtcaagctgactgagatatactatgcagggagtcatggtatggac
atactagcatcttttgcagattcagacagtaccatagaaaagaccaaagaaaccaagctt
tttcaacctgcaaatgagtttctgactatgataactgaggtttccaaatccctgatagag
gtcactaaagcgattaagggtgcaacagttgagaacaacaagttttgcgtatctgttcat
tatcgtaatgtcgacaagaagaactggaagttggtcgcacaggttgtcaacaatgttcta
aaagattttcctagtcttaaagtatccactggacggaaggttttagaggttcgtccaatg
atcaactgggacaagggaaaagccgtcgagtttttgcttcgatcgcttgagctagatgat
tctgaaactgttcttcctatctatattggggatgataaaacggatgaagatgcattcaag
gtgcttcgcgagcgaaagaatggatgtgggattcttgtttcgcaggtgcccaagaagtct
gaagcctttttcatgctgagaggcccatcagaagtgatggaatttctcagttccttggtg
agatggaaggaacaatcaacatttgaagattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324423
Entry
4324423           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324423
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4324423
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4324423
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4324423
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4324423
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4324423
NCBI-ProteinID: XP_015621200
UniProt: A0A0P0V7R6 Q7F6J7
LinkDB
Position
1:30459902..30464461
AA seq 878 aa
MFSRSYTNLVDLANGNLSALDYGGGGGGGGGGNGAGGRPPRARRMQRTMTTPGTLAELDE
ERAGSVTSDVPSSLASDRLIVVANTLPVRCERRPDGRGWSFCWDEDSLLLHLRDGLPDDM
EVLYVGSLRADVPSAEQDDVAQALLDRFRCVPAFLPKDVLDRFYHGFCKQTLWPLFHYML
PFTSDHGGRFDRSQWEAYVLANKLFSQRVIEVLNPEDDYIWIHDYHLLALPSFLRRRFNR
LRIGFFLHSPFPSSELYRSLPVRDEILKSLLNCDLIGFHTFDYARHFLSCCSRMLGIEYQ
SKRGYIGLDYFGRTVGIKIMPVGINMTQLQTQIRLPDLEWRVAELRKQFDGKTVMLGVDD
MDIFKGINLKVLAFEQMLRTHPKWQRKAVLVQIANPRGGGGKDLEEIQAEIDESCRRINA
QFSRPGYVPVVIINRALSSVERMAYYTVAECVVVTAVRDGMNLTPYEYIVCRQGFPDLDG
SGDDGPRRKSMLVVSEFIGCSPSLSGAIRVNPWNIDTTAEAMNESIALSENEKQLRHEKH
YRYVSSHDVAYWSKSYIHDLERSCRDHFRRRCWGIGLGFGFRVVALDRNFKKLTVDSIVT
DYKNSKSRVILLDYDGTLVPQTTINRTPNESVVKIMNALCDDKKNVVFIVSGRGRDSLEK
WFSPCQDLGIAAEHGYFMRWTRDEQWQLNNQCSEFGWMQMAKPVMNLYTEATDGSYIETK
ESALVWHHQDADPGFGSSQAKEMLDHLESVLANEPVCVKSGQQIVEVKPQGVSKGFVAEK
ILSTLTENKRQADFVLCIGDDRSDEDMFEGIADIMRRSIVDPQTSLYACTVGQKPSKAKY
YLDDTNDVLNMLEALADASEETDSQEDAEEITSIPDPE
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgttctcgcgatcctacaccaacctggtcgatctcgccaacggcaacctctccgccctg
gactatggtggcggagggggagggggcggcggcggcaacggggccgggggccggccgccg
cgggcgaggcggatgcagcggacgatgacgacgcccgggacgctggcggagctcgacgag
gagcgggccgggagcgtcacctccgacgtgccctcgtcgctcgccagcgaccgcctcatc
gtcgtcgccaacaccctccccgtgcgctgcgagcgccgccccgacgggcgcgggtggagc
ttctgctgggacgaggactccctcctcctccacctccgcgacggcctccccgatgacatg
gaggtcctctacgtcggctccctccgcgccgacgtgccgtccgccgagcaggacgacgtc
gcgcaggcgctcctcgaccggttccgctgcgtcccggctttcctccccaaggacgtcttg
gacagattctaccatggcttctgcaagcagacgctgtggccgctcttccactacatgctc
cccttcacctccgaccatggcggccgcttcgatcgctcccagtgggaggcatacgtcctc
gccaacaagctcttctcccagcgcgtcatcgaggtcctcaaccccgaggatgactacatc
tggatccacgattaccacctcctcgccctcccgtccttccttcgccgtcggttcaacagg
ctccgcatcggtttcttcctgcacagcccgttcccttcgtcggaactctaccgttccctc
cctgttcgcgacgagatcctcaaatcactgctaaactgcgatctgattgggttccacacc
tttgattacgcgcggcatttcctgtcctgctgcagccggatgctggggatcgagtaccag
tcgaagaggggatatatcggtctcgattactttggccgcactgttgggataaagatcatg
cctgttgggattaacatgacgcagctgcagacgcagatccggctgcctgatcttgagtgg
cgtgtcgccgaactccggaagcagtttgatgggaagactgtcatgctcggtgtggatgat
atggacatatttaaggggattaatctgaaagttcttgcgtttgagcagatgctgaggaca
cacccaaaatggcagcgcaaggcagtgttggtgcagattgcaaacccaaggggtggtggt
gggaaggaccttgaagagatacaggctgagattgatgagagttgcaggaggataaatgca
caattttcacggccaggatatgttcctgtggtgattatcaatagagccctttcaagtgtg
gagaggatggcttattataccgtggcagagtgtgtcgttgtaactgcagtgagggatggg
atgaacctcacaccatatgagtatattgtctgtagacagggatttccagatttggatggt
tctggggatgatgggccaaggagaaagagtatgttagttgtgtccgaattcattggttgc
tcaccatcacttagtggagcaattcgggtaaacccttggaacattgatacaacagcagag
gcaatgaacgagtcgattgctttatcagagaacgagaagcaactgcggcatgagaagcat
tacagatatgtcagctcacatgatgttgcctattggtccaagagctatattcatgatttg
gagagaagctgcagggaccattttaggaggaggtgctggggtattggactaggatttgga
tttagagtagttgctcttgaccgcaacttcaaaaagcttactgtggattctatcgttact
gattacaagaattctaagagcagggttatactgctagactacgatggaacgctagtacca
caaactacaatcaacaggactccaaatgaaagtgttgttaaaatcatgaatgctctttgt
gacgataagaagaatgttgtttttattgttagtggacgaggaagggatagccttgagaaa
tggttttccccttgccaggatcttggcattgctgccgaacatggctactttatgaggtgg
accagagatgagcaatggcaattgaataaccagtgctcagaatttggatggatgcagatg
gccaagccagttatgaacctgtatacagaagcaaccgatggatcatatattgaaaccaaa
gagagtgctttggtctggcaccaccaagatgctgaccctggttttggatcttcacaagct
aaagagatgctagatcatttggaaagtgttcttgctaatgagcctgtctgtgtaaagagt
ggccaacagattgtggaagtgaaaccgcagggtgtcagcaaaggatttgttgctgagaag
atcctatcaacgctgacagagaacaagagacaggcagattttgttctctgcataggcgat
gatagatcagacgaggatatgtttgaaggaattgctgatatcatgagaaggagcatagtt
gatccccaaacatcattatatgcgtgcacagtcggccagaagccaagcaaggctaagtac
tatttggacgatactaatgatgttttgaacatgcttgaggcgcttgcagatgcatcagag
gagactgattcacaggaagatgcagaagagataacatctatcccggacccggaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324621
Entry
4324621           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324621
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4324621
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4324621
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4324621
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4324621
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4324621
NCBI-ProteinID: XP_015647552
UniProt: Q5JNJ1 B9EZN8
LinkDB
Position
1:complement(31373446..31377544)
AA seq 913 aa
MMSRSYTNLLDLAEGNFAALGPGGGGGGRRRSGSFGLKRMSRVMTVPGTLSELDGEDDSE
HAATNSVASDVPSSVAGDRVIVVSNQLPVVARRRPDGRGWSFSWDDDSLLLQLRDGIPDE
MEVFFVGSLRAEIPVADQEEVSQALLDRFRCAPVFLPDPLNERFYHRFCKRHLWPLFHYM
LPFSSSASPSPSSSSSSSSSPSSSSGSGHFDRGAWEAYVLANKFFFEKVVEVINPEDDYV
WVHDYHLMALPTFLRRRFNRLRIGFFLHSPFPSSEIYRTLPVREEILKALLNCDLIGFHT
FDYARHFLSCCSRMLGIEYQSKRGYIGLDYFGRTVGIKIMPVGVHMGQLKTVLSLPDREW
RVSELQQQFEGKTVLLGVDDMDIFKGINLKLLAFENMLRTHPKWQGRAVLVQIANPARGK
GKDLEAIQAEIHESCKRINGEFGQSGYSPVVFIDRDVSSVEKIAYYTIAECVVVTAVRDG
MNLTPYEYIVCRQGSDSTSEVNGPKKSMLVVSEFIGCSPSLSGAIRVNPWNIEATAEALN
EAISMSEQEKHLRHEKHYRYVSTHDVAYWSKSFIQDLERACKDHFRRTCWGIGLGFGFRV
VALDPHFTKLNMDSIVMAYERSESRAIFLDYDGTLVPQTSISRTPSAEVLRIINTLCSDR
RNKVFLVSGRRRDKLGEWFSSCPDLGIAAEHGYFLRWTRDEEWQTCTQTSDFGWMEMAKP
VMNLYTEATDGSYIDPKESALVWHHQDADPGFGSSQAKELLDHLESVLANEPVSVKSGQF
IVEVKPQGVSKGVVAEKILVSMKERGKQADFVLCIGDDRSDEDMFENIADTIKKGMVATN
TSLFACTVGQKPSKAKFYLDDTFEVVTMLSALADATEPEPETDLTDEFDELAVSVSSVDI
DDEQTPSDKLIGG
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgatgtcgcggtcgtacaccaaccttctcgatctcgcggaggggaacttcgcggcgttg
ggcccgggaggcggcggcggcgggaggcggaggtcggggtcgttcgggctgaagcggatg
tcgcgggtgatgacggtgcccgggacgctgtcggagctggacggggaggacgactcggag
cacgcggcgacgaacagcgtcgcctccgacgtgccctcgtcggtggcgggggatcgagtc
atagtggtctccaaccagctgcccgtcgtcgcacgccgccgtcccgacggccgcgggtgg
tccttctcatgggacgacgactcgctgctcctccagctccgcgacggcattcccgatgag
atggaggtgttcttcgtcggttccctccgcgccgaaatccccgtcgccgaccaggaagag
gtctcccaggcgctgctcgatcgcttccgatgtgctccggtgttcctccccgaccccctc
aacgaacggttttaccaccgcttctgcaagcgccacctatggcctctgttccactacatg
ctccctttctcctcctccgcatccccgagtccctcctcctcctcctcctcctcctcctcc
ccctcatcctcatccggcagtggccacttcgaccgcggcgcgtgggaggcctacgtgctc
gcgaacaagttcttcttcgagaaggtcgtggaggtcatcaacccagaagacgactacgta
tgggttcacgactaccatctcatggcgctgcccaccttccttcgccgccgcttcaaccgc
ctgcgcatcggcttcttcctccacagccccttcccctcgtcggagatctaccggaccctc
cctgttcgcgaggagatcctaaaggcgctgctcaattgtgaccttattggattccacact
tttgactatgccagacatttcctctcttgttgtagtaggatgctgggaattgaataccag
tcaaagcgtggatacattgggttggattactttgggcgtaccgttgggatcaaaatcatg
ccagtgggagttcatatgggtcaattgaagacggttctgagcttgcccgacagggaatgg
agggtctccgagctgcagcagcaatttgaggggaagactgtgttgctcggtgtggatgac
atggatatcttcaagggtatcaacttgaagcttcttgccttcgagaatatgttgaggaca
catcccaagtggcaggggcgggcagtgttggtgcaaattgctaatccggcccgtggaaag
ggtaaggatcttgaagccatccaggctgagattcatgagagctgcaagaggattaatgga
gagtttggccagtcaggatacagccctgttgtcttcattgaccgtgatgtgtcaagtgtg
gagaagattgcctactacacaatagcagaatgtgtggtggtgactgctgtgagggatggg
atgaacttgacaccatatgaatatattgtctgtaggcaggggtctgactccacatcagaa
gtgaatggaccaaagaagagcatgctggtggtatcagaattcattgggtgctcaccatct
ctgagtggtgctatccgggttaacccatggaatatagaggcaaccgcagaggcactgaat
gaggccatatcaatgtcggaacaggagaaacacctaaggcatgagaaacattaccgttat
gtcagcacccacgatgttgcttattggtcgaaaagtttcatccaagatttggagagggct
tgcaaggaccacttcaggaggacatgttggggcatcgggttggggtttggttttagggtg
gtggccttagatccccatttcacaaagcttaacatggattcaattgttatggcttatgag
cggtcagagagtagggctatatttcttgattatgatggaacactggtgccacagacttcc
atcagtaggacacctagtgcggaagttttgaggatcatcaataccctgtgctcagatagg
aggaacaaagtttttcttgtcagtgggagacgcagggacaaattgggagaatggttttcc
tcttgtccagatctgggcattgcagcagagcatggttacttcttaaggtggactagagac
gaagagtggcaaacatgtacccagacctctgacttcgggtggatggaaatggccaagcca
gtgatgaatctgtatacagaagcaactgatggatcttacattgatcctaaggaaagtgct
ttggtgtggcatcaccaggatgctgacccaggatttggatcctcccaggcaaaggagtta
cttgatcatctggaaagtgtattagcaaatgaacctgtttctgtcaaaagtggccagttc
attgttgaagtcaaacctcagggagtaagcaagggagtagtagctgagaagatactcgtc
tcaatgaaggagagaggaaagcaggctgactttgtattatgcattggtgatgacaggtcg
gatgaggacatgtttgaaaacattgctgataccattaaaaagggtatggttgctacaaac
acatcattgtttgcatgcactgtgggacaaaaaccaagcaaggccaaattttacctggat
gatacgtttgaagtggtcaccatgctgagcgcactggcagatgctactgaaccagaacct
gagactgatcttaccgatgagtttgatgaactggccgtgtctgtctcctcagttgatatt
gatgatgaacaaacgcccagtgataaactgatcggaggatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330221
Entry
4330221           CDS       T01015                                 
Name
(RefSeq) probable trehalose-phosphate phosphatase 1
  KO
K01087  trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330221
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4330221
SSDB
Motif
Pfam: Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4330221
NCBI-ProteinID: XP_015623255
UniProt: Q75WV3
LinkDB
Position
2:complement(26767617..26771696)
AA seq 371 aa
MDLSNSSPVITDPVAISQQLLGGLPSNLMQFSVMPGGYSSSGMNVGVSRLKIEEVLVNGL
LDAMKSSSPRRRLNVAFGEDNSSEEEDPAYSAWMAKCPSALASFKQIVASAQGKKIAVFL
DYDGTLSPIVDDPDKAVMSPVMRAAVRNVAKYFPTAIVSGRSRNKVFEFVKLKELYYAGS
HGMDIMAPSANHEHSAEKSKQANLFQPAHDFLPMIDEVTKSLLQVVSGIEGATVENNKFC
VSVHYRNVAEKDWKLVARLVNEVLEAFPRLKVTNGRMVLEVRPVIDWDKGKAVEFLLQSL
GLNDSENVIPIYIGDDRTDEDAFKVLRQRNCGYGILVSQVPKETEAFYSLRDPSEVMEFL
NFLVRWKKHSV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggatttgagcaatagctcacctgtcatcaccgatccggtggcgatcagccagcagttg
ttgggcggcctgccttcaaatctgatgcagttttcagtcatgcccggtggctactccagc
tctggcatgaacgttggtgtcagtaggctcaaaatcgaggaagtccttgtcaatggactg
cttgatgccatgaaatcctcgtcacctcgcaggaggctgaatgtagcatttggcgaggac
aattcatctgaagaagaagaccctgcttacagcgcttggatggcaaaatgtccttctgct
ttggcttccttcaagcaaattgtagccagtgcacaagggaagaagattgctgtgtttcta
gactatgacggcacactgtcgcctattgtggatgatcctgacaaagcagtgatgtctccc
gtgatgagagctgctgtgagaaatgttgcgaagtacttccccactgcaattgtcagcgga
aggtcccgcaataaggtgtttgaatttgtaaaactgaaggagctttattatgctggaagc
catggtatggacataatggcaccttcagcaaatcatgagcacagtgctgaaaagagcaaa
caggccaatctcttccaacctgcacacgactttctgccaatgatcgatgaggttaccaag
tccctcttgcaagttgtcagtggaattgaaggtgcaactgttgagaacaacaaattctgc
gtttctgtacattatcgcaacgttgcagagaaggattggaaactggtcgcacggctcgta
aacgaagtgctggaggcttttcctcgtctcaaagtaaccaatggacgaatggttttagag
gttcgtccggtgatcgactgggacaagggaaaggctgtggagtttctgctccagtcactc
gggctaaatgactctgaaaatgtgatccccatctacattggagacgacagaactgacgaa
gacgctttcaaggtacttcgacagcgaaattgcggttatggaatactagtttcacaggtt
cccaaggaaactgaagccttctactcgctgagagatccatctgaagtgatggagttcctc
aatttcttggtgagatggaagaagcactcagtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330753
Entry
4330753           CDS       T01015                                 
Name
(RefSeq) probable trehalose-phosphate phosphatase 4
  KO
K01087  trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330753
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4330753
SSDB
Motif
Pfam: Trehalose_PPase
Other DBs
NCBI-GeneID: 4330753
NCBI-ProteinID: XP_015623803
UniProt: Q6ZGP8
LinkDB
Position
2:31663082..31666292
AA seq 367 aa
MTNQDVVVSEMGIAAGAALPGGPAGPAGGLFACRSAAASMRQTYLDLAAAAVAARSASCT
SWADAMRASSPTRSSRSASDVDEFTAWVRKHPSALSKFEEIAAKSRGKKIVMFMDYDGTL
SPIVADPDTAYMSDAMRAAVREVAKTFPTAIVSGRCRDKVRNFVGLSDLYYAGSHGMDIK
GPSSNPESALCQPASEFLPMIDEVYKTLVEKTKSTPGAKVENNKFCLSVHFRCVDEKRWN
ALGEQVKAVIKEYPKLKLTQGRKVLEIRPSIEWDKGKALEFLLESLGFANCGDVMPVYIG
DDRTDEDAFKVLRKRGQGLGILVSKCPKDTNASYSLQDPTEVMEFLLRLVEWKRKSSSSS
LMIRPRV
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgacgaaccaggacgtggtggtttctgagatgggcatcgcggcaggcgcggcgctgccg
ggaggaccggccggcccggcgggcggcctcttcgcgtgccgcagcgcggccgcgtcgatg
aggcagacgtacctcgacctcgccgcggcggcggtggcggcgcgctccgcgagctgcacc
agctgggccgacgccatgcgcgcctcctcccccacccgctcgtcccgctccgcctccgac
gtcgacgagttcaccgcctgggtgaggaagcacccgtcggcgcttagcaagttcgaggag
atcgccgccaagtccagggggaagaagatcgtaatgttcatggactacgacggcacgctc
tctcccatcgtcgccgaccccgacacggcctacatgagcgacgcgatgagggcggcggtg
cgcgaagtcgccaagaccttcccgacggcgatcgtcagcgggcggtgccgcgacaaggtt
cgcaacttcgtcggcctctccgacctctactacgccggcagccatggcatggacatcaag
ggaccaagctccaacccggagtctgccctttgccagccagcaagcgagttcctccccatg
atcgacgaggtgtacaagacgctggtggaaaagacgaaatctacacctggagccaaggtg
gagaacaacaagttctgcctgtccgtccacttcagatgtgtagatgaaaagagatggaat
gctttgggggagcaggtcaaggccgtgatcaaggaatacccaaagttgaagcttacccaa
ggaaggaaggttttggagatcaggccgagcattgagtgggacaagggcaaggctctggag
ttcttgcttgaatcgctgggattcgccaactgcggcgacgtcatgccggtgtacatcggt
gacgaccgcaccgacgaggacgccttcaaggtgttgagaaagagaggtcagggcctggga
atcctagtctccaagtgccccaaggacaccaacgcctcctactctctccaggacccaaca
gaggtgatggagttcttgctcaggctggtggagtggaagcggaagtcgtcgtcgtcgtcg
ttgatgattcgtccgagagtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330971
Entry
4330971           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4330971
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4330971
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4330971
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4330971
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4330971
NCBI-ProteinID: XP_015625782
UniProt: A3AC56
LinkDB
Position
2:33569238..33573166
AA seq 847 aa
MPSLSCHNLLDLVAAADDAAPSPASLRLPRVMSAASPASPTSPSTPAPARRVVVSHRLPL
RAAADAASPFGFSFTVDSDAVAYQLRSGLPPGAPVLHIGTLPPPATEAASDELCNYLLAN
FSCLPVYLPADLHRRFYHGFCKHYLWPLLHYLLPLTPSSLGGLPFDRALYHSFLSANRAF
ADRLTEVLSPDDDLVWIHDYHLLALPTFLRKRFPRAKVGFFLHSPFPSSEIFRTIPVRED
LLRALLNADLVGFHTFDYARHFLSACSRLLGLDYQSKRGYIGIEYYGRTVTVKILPVGID
MGQLRSVVSAPETGDLVRRLTESYKGRRLMVGVDDVDLFKGIGLKFLAMEQLLVEHPELR
GRAVLVQIANPARSEGRDIQEVQGEARAISARVNARFGTPGYTPIVLIDRGVSVHEKAAY
YAAAECCVVSAVRDGLNRIPYIYTVCRQESTGLDDAAKRSVIVLSEFVGCSPSLSGAIRV
NPWSVESMAEAMNAALRMPEPEQRLRHEKHYKYVSTHDVAYWAKSFDQDLQRACKDHFSR
RHWGIGFGMSFKVVALGPNFRRLSVDHIVPSYRKSDNRLILLDYDGTVMPEGSIDKAPSN
EVISVLNRLCEDPKNRVFIVSGRGKDELGRWFAPCEKLGIAAEHGYFTRWSRDSAWETCG
LAVDFDWKKTAEPVMRLYKEATDGSTIEDKESALVWHHDEADPDFGSCQAKELLDHLENV
LANEPVVVKRGQHIVEVNPQGISKGVVVDNLLSSMVSRGKAPDFVLCIGDDRSDEDMFES
IVCPSNSSVKLPASSEVFACTVGKKPSMAKYYLDDTVDVIKMLQGLANAPSQRPRQVQLR
VSFEGSL
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgccttcgctctcctgccacaacctcctcgacctcgttgccgcggcggacgacgcggcg
ccgtcgcccgcgtcgctgcgcctcccgcgcgtcatgtcggcggcgtcgccggcctcgccc
acgtcgccgtccacgccggcccccgcgcggagggtggtcgtgtcgcaccgcctcccgctc
cgcgccgcggccgacgcggcgtcgccgttcgggttctccttcacggttgactcggacgcc
gtcgcgtaccagctccgctcggggctgccccccggcgcgcccgtcctccacatcggcacg
ctcccgccgcccgcaaccgaggcggcctccgacgagctctgcaactacttgctggcgaac
ttctcttgcctgccggtgtacttgcccgccgatctccaccgccgattctaccatggattc
tgcaagcactacctgtggcctctcctccattaccttctgccgctcacgccgtcgtcgctg
ggcgggttgccgttcgaccgcgcgctctaccattctttcctctcggcgaaccgggccttc
gccgaccgcctcaccgaggtgctcagccccgacgacgacctcgtctggatccacgattac
cacctccttgccctccccaccttcctccgcaagcgattcccgcgcgccaaggtcggtttc
ttcctccactcgccgttcccctcctcggagatcttccgcaccattcccgtcagggaggac
ctcctccgcgccctcctcaacgccgacctcgtcggcttccacaccttcgactacgcgcgc
cacttcctctccgcctgctcgcggctgctcggcctggattaccagtccaagcgcggctac
atcggcatcgagtactatggtcgcaccgtcacggtcaagattctgcccgtcgggatcgac
atgggccagctgaggtcggtggtgtcggcgccggagacgggggacctggtgcggcggctc
accgagtcgtacaaggggcggcgcctgatggtcggcgtcgacgacgtcgacctgttcaag
ggaatcgggctcaagttcctggcgatggagcagctgctggtggagcacccggagctgcgc
ggccgcgcggtgctcgtgcagatcgcgaacccggcgcgcagcgaggggcgcgacatccag
gaggttcagggagaagccagggcgatcagcgcccgcgtcaatgcgcggttcggcacgccg
gggtacacccctatcgtgctgatcgaccgcggtgtgtcggtgcacgagaaggcggcgtac
tacgcggcggccgagtgctgcgtggtgagcgccgtgcgggacggcctcaaccggataccc
tacatctacacggtgtgccggcaggagagcactggcctggatgatgcggccaagcgcagc
gtcattgtgctgtcggagttcgtcgggtgctccccgtcgctcagcggcgcaatccgggtc
aacccatggagtgtggagtctatggcagaggccatgaatgcagccctgaggatgcctgag
ccagagcagcggctgcgacatgagaagcactacaagtatgtgagcacccatgatgttgcc
tactgggcgaaatctttcgaccaggacctgcagcgagcttgcaaggatcatttctcgcgg
cggcattggggtattgggtttgggatgagtttcaaggtggtggcacttggcccgaatttc
aggcggctgtctgtcgatcacattgtgccgtcataccggaagtctgataatcgcttaatt
ctcttggactatgatggcacagtgatgccagagggttcaattgataaggcaccgagcaat
gaggtcatctctgtattgaatcgtctgtgcgaggaccccaagaacagagtgttcatcgtg
agcggtagagggaaggatgaacttggcagatggtttgcaccttgtgagaagctggggatt
gctgcagagcatggttacttcacaaggtggagcagggactcagcttgggagacctgcggg
ttggccgtggactttgattggaagaagactgcagaaccagtgatgaggctttacaaggag
gcaacagatggttcaaccatcgaagacaaggaaagcgcgttagtttggcaccacgatgag
gcagatccagattttggttcatgccaggcaaaggaactgcttgaccacctcgaaaacgtt
cttgcaaatgaaccagtcgttgttaagaggggccagcatatcgtcgaagtaaatccacag
ggcatcagcaaaggtgtggttgtggacaacctcttgtcatccatggtgagccgagggaag
gcgcccgatttcgtgctgtgcattggggacgaccggtcggacgaggacatgttcgagagc
atcgtttgcccgtcgaacagcagcgtcaagctcccggcgagcagcgaggtgttcgcctgc
acggtcggcaagaagccgagcatggccaagtactacctcgacgacacggtcgacgtgatc
aagatgctgcagggtctcgccaatgcgccatcgcagcggccaaggcaagtgcagctgcgg
gtctcgttcgaaggctcactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332112
Entry
4332112           CDS       T01015                                 
Name
(RefSeq) alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4332112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4332112
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4332112
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4332112
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4332112
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4332112
NCBI-ProteinID: XP_015630576
UniProt: Q10PR5 Q8H7S6
LinkDB
Position
3:complement(6519054..6523482)
AA seq 860 aa
MVSRSYSNLLDLATGAADQAPAPAALGALRRRLPRVVTTAGLIDDSPLSPSTPSPSPRPR
TIVVANHLPIRAHRPASPSEPWTFSWDEDSLLRHLQHSSSSPAMEFIYIGCLRDDIPLAD
QDAVAQALLESYNCVPAFLPPDIAERYYHGFCKQHLWPLFHYMLPLSPDLGGRFDRALWQ
SYVSANKIFADKVLEVINPDDDFVWVHDYHLMVLPTFLRKRFNRIKLGFFLHSPFPSSEI
YKTLPVREELLRALLNSDLIGFHTFDYARHFLSCCGRMLGLSYESKRGHICLEYYGRTVS
IKILPVGVNMGQLKTVLALPETEAKVAELMATYSGKGRVVMLGVDDMDIFKGISLKLLAM
EELLRQHPEWRGKLVLVQVANPARGRGKDVDEVKGETYAMVRRINEAYGAPGYEPVVLID
EPLQFYERVAYYVVAEVCLVTAVRDGMNLIPYEYIVSRQGNEALDRMLQPSKPEEKKSML
VVSEFIGCSPSLSGAVRVNPWNIEAVADAMESALVLPEKEKRMRHDKHYRYVDTHDVGYW
ATSFLQDLERTCKDHAQRRCWGIGFGLRFRVVSLDLSFRKLAMEHIVMAYRRAKTRAILL
DYDGTLMPQAINKSPSANSVETLTSLCRDKSNKVFLCSGFEKGTLHDWFPCENLGLAAEH
GYFLRSSRDAEWEISIPPADCSWKQIAEPVMCLYRETTDGSIIENRETVLVWNYEDADPD
FGSCQAKELVDHLESVLANEPVSVKSTGHSVEVKPQGVSKGLVARRLLASMQERGMCTDF
VLCIGDDRSDEEMFQMITSSTCGESLAATAEVFACTVGRKPSKAKYYLDDTAEVVRLMQG
LASVSNELARAASPPEDDDE
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggtttctcggtcctactccaacctgctggacctggccaccggcgcggcggaccaggcg
ccggcgccggcggcgctcggcgcgctccggcggcggctgccgcgggtggtgaccaccgcg
gggctcatcgacgactccccgctgtccccctcgacgccgtccccgtcgccgcggccgcgc
accatcgtggtcgccaaccacctccctatccgggctcaccgcccggcgtcgccgtcggag
ccgtggaccttctcctgggacgaggactccctcctccgccacctccagcactcgtcctcc
tcccccgccatggagttcatctacatcggctgcctccgcgacgacatcccgctggccgac
caggacgccgtcgcgcaggcgctcctcgagtcgtacaactgcgtgccggcgttcctgccc
cccgacatcgccgagcgctactaccatggcttctgcaagcagcatctgtggccgctgttc
cactacatgctgccgctctcccccgacctcggcggccgcttcgaccgcgcgctgtggcag
tcgtacgtgtcggcgaacaagatcttcgcggacaaggtgctcgaggtgatcaacccggac
gacgacttcgtgtgggtgcacgactaccacctcatggtgctcccaaccttcctccgcaag
cgcttcaaccgcatcaagctcggcttcttcctccactcgccgttcccctcgtcggagatc
tacaagacgctccccgtccgggaggagctcctgcgcgcgctgctcaactccgacctcatc
ggcttccacaccttcgactacgcgcgccacttcctctcctgctgcggccggatgctgggg
ctctcctacgagtccaagcgtggccacatctgcttggagtactacggccggacggtgagc
atcaagatcctcccggtgggggtgaacatggggcagctcaagacggtgctcgcgttgccg
gagacggaggcgaaggtggcagagctgatggcgacttactccgggaaggggagggtcgtc
atgctgggcgtcgacgacatggacatcttcaaggggatcagcctcaagctgctcgccatg
gaggagctgctgcggcagcaccccgagtggcgcggcaagctggtgctcgtccaggtcgcg
aacccggcgcgcggccgcggcaaggacgtcgacgaggtgaagggggagacgtacgccatg
gtgcggcggatcaacgaggcgtacggcgcgcccgggtacgagccggtggtgctcatcgac
gagccgctccagttctacgagcgcgtggcgtactacgtcgtcgccgaggtgtgcctggtg
accgcggtccgcgacggcatgaacctgatcccctacgagtacatcgtgtccaggcagggc
aacgaggcgctcgacaggatgctgcagccgagcaagccggaggagaagaagagcatgctg
gtggtgtccgagttcatcgggtgctcgccgtcgctgagcggcgcggtgagggtgaacccg
tggaacatcgaggccgtggcggacgccatggagagcgcgctcgtgctgccggagaaggag
aagcggatgcgccacgacaagcactaccgctacgtggacacccacgacgtgggctactgg
gcgaccagcttcctgcaggacctcgagaggacgtgcaaggatcacgcgcagcggcggtgc
tggggcatcggcttcgggctgcggttcagggtggtgtcgcttgacctcagcttcaggaag
ctcgccatggagcacattgtcatggcgtaccggagggcgaagacgcgcgccatcctgctc
gactacgacggcacgctcatgccgcaggcgatcaacaagagcccgagcgccaattccgtc
gaaacgctgaccagcttgtgcagggacaagagcaacaaggttttcctctgcagcgggttc
gagaagggaacactccatgactggttcccctgcgagaaccttggcttggcggctgagcac
ggttacttcctgaggtcatcgagggatgcagagtgggagatttccattccccccgcggac
tgcagctggaagcagatcgcggagccggtgatgtgcctgtacagggagaccacggacggc
tcgatcatcgagaacagggagacggtgctcgtctggaactacgaggacgcagaccctgac
ttcggttcatgccaagccaaggagctcgtcgaccacctcgagagcgtgctcgccaacgag
cccgtctcggtgaagagcaccggccattccgttgaggtcaagccacagggcgtgagcaag
ggcctggtggcgcggcggctgctggcgagcatgcaggagaggggcatgtgcaccgacttc
gtgctgtgcatcggggacgaccgctccgacgaggaaatgttccagatgatcacaagctcc
acctgcggcgagtcgctggcggccacggcggaggtcttcgcctgcaccgtcggccgcaag
ccgagcaaggccaagtactacctcgacgacacggcggaggtcgtcaggctgatgcagggc
ttggcctccgtctccaacgagctggctcgggcggcgagccccccggaggacgacgacgaa
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332996
Entry
4332996           CDS       T01015                                 
Name
(RefSeq) probable trehalose-phosphate phosphatase 9
  KO
K01087  trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4332996
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4332996
SSDB
Motif
Pfam: Trehalose_PPase
Other DBs
NCBI-GeneID: 4332996
NCBI-ProteinID: XP_015628649
UniProt: Q10KF5
LinkDB
Position
3:15381794..15384223
AA seq 374 aa
MTKHGAVVVPEDAVVAAAAVGRHFSFPPPRTGGVGGDSCKKLAAQQIDLGAAVIGSWLDS
MKASSPRHRLVAPAVAAAAADAEHDEWMEKHPSALGKFEALAAAAKGKRIVVFLDYDGTL
SPIVEDPDRAVMTDEMRDAVRGVAARFPTAIVSGRCRDKVLSFVGLEELYYAGSHGMDIQ
GPTNAAASKGGEEEEESVLCQPAREFLPMIGEAYAALVEKVEGVIPGAKVENNKFCLSVH
FRRVDERRWGAVADQVRAVLRGYPRLRLTQGRKVLEVRPAIKWDKGEALRFLLSALGFSA
AGDVEDDGDDDDAFPIYIGDDRTDEDAFRVLRARGHGAGILVSRFPKDTCASFSLRDPGE
VKDFLRKLVTCAAA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgacgaagcacggcgcggtggttgtcccggaggatgccgtggtggcggcggcggccgtc
gggcggcatttctcgttcccgccgccgaggacggggggcgtcggcggcgactcgtgcaag
aagctggcggcgcagcagatcgacctcggcgccgcggtgatcgggtcgtggctcgactcc
atgaaggcgtcctcgccgcggcacaggctcgtggcgcccgcggtcgccgccgccgccgcc
gacgcggagcacgacgagtggatggagaagcacccgtcggcattggggaagttcgaggcg
ctggcggcggcggcgaaggggaagcggatcgtcgtcttcctcgactacgacggcacgctg
tcgccgatcgtcgaggaccccgaccgcgccgtcatgacggacgagatgagggacgccgtg
cgcggcgtggcggcgcgattcccaacggcgatcgtcagcggccgctgcagagacaaggtg
ttgagcttcgtggggctggaggagctctactacgcgggtagccacgggatggacatccaa
gggcccaccaacgccgccgcctccaagggaggagaggaggaggaggagtcggtgctgtgc
cagccggcgagggagttcctgccgatgatcggggaggcgtacgcggcgctggtggagaag
gtggagggggtgatcccgggggcgaaggtggagaacaacaagttctgcctctccgtccac
ttccgccgcgtcgacgagcgccggtggggcgccgtcgccgaccaggtcagggcggtgctc
cggggctacccgcgcctccgcctcacgcagggccgcaaggtgctcgaggtcaggcccgcc
atcaagtgggacaagggcgaggccctccgcttcctcctctccgccctcggcttctccgcc
gccggagacgtagaagacgacggcgacgacgacgacgcgttccccatctacatcggcgac
gaccgcaccgacgaggacgcgttccgggtgctccgagcgagggggcacggcgccggcatc
ctggtgtcgaggttccccaaggacacctgcgcctccttctccctccgcgaccccggcgag
gtcaaggacttcctccgcaagctcgtcacctgcgctgccgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339327
Entry
4339327           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4339327
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4339327
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4339327
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4339327
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4339327
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4339327
NCBI-ProteinID: XP_015640013
UniProt: A0A0P0WPQ7 Q75II7
LinkDB
Position
5:25641603..25646405
AA seq 899 aa
MMSRSYTNLLDLAAGNFEALGPAGGGRRRSFGAKRMTRVMTVPGTLSELDDEDDEPAATS
SVASDVPSSAACERLIVVANQLPVVARRRPGAAAGGWAFSWDDDSLLLRLRDGVPDEMEV
LFIGTLRADVPACEQDEVSQSLIDGFGCAPVFLPAGLYDRFYQHFCKGYLWPLFHYMLPF
ASALPAAASGDGRFDRGAWEAYVLANKYFFEKVVEVINPEDDYVWVHDYHLMALPTFLRR
RFNRLRIGFFLHSPFPSSEIYRSLPVREEILRTLLNCDLIGFHTFDYARHFLSCCSRMLG
IEYQSKRGYIGLDYFGRTVGIKIMPVGIHMGQLQSVLRLSEKEKKVAELRQQFEGKSVLL
GVDDMDIFKGINLKLLAFENMLRTHPKWKGRAVLVQIANPARGKGKDLEAVQAEIRESCD
RINKEFGQSGYSPVIFIDQSVPSAVRLAYYTVAECVVVTAVRDGMNLTPYEYIVCREGIP
GSECAPEVSGPKKSMLVVSEFIGCSPSLSGAIRVNPWNIEATAEALNEAISMSEREKQLR
HEKHYRYVSTHDVAYWSKSFVQDLERACKDHFRKPCWGIGLGFGFRVVALDPHFTKLNFD
SIIMSYERSKSRAIFLDYDGTLVPQASLNKNPSEELLRIINTLCADRNNTVFIVSGRSKD
DLSKKLISCPKLGIAAEHGYFLRWTRDEEWQTTAQTSDFGWMQMAKPVMDLYTESTDGST
IETKETALVWHHQDADQGFGSSQAKEMLDHLESVLANEPVSVKSGQFIVEVKPQGVTKGL
IAEKVLTSMKEKGQLADFVLCIGDDRSDEDMFENIADVMKRSIVAPKTPLFACTVGQKPS
KARFYLDDTFEVVTMLSSLADASEPDLMADLEDDLATSVSSIEISDRVVSFSNLRTEGS
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgatgtcgaggtcgtacacgaacctgctggacctcgcggcggggaacttcgaggcgctg
gggccggcggggggagggaggaggaggtcgttcggggcgaagcggatgacgcgggtgatg
acggtgcccgggacgctgtcggagctggacgacgaggacgacgagccggcggcgacgagc
agcgtcgcctccgacgtgccctcgtcggcggcgtgcgagcgcctcatcgtcgtggcgaac
cagctccccgtggtggcgcggcggaggccgggcgccgcggcgggggggtgggcgttctcg
tgggacgacgactcgctcctcctccgcctccgcgacggcgtccccgacgagatggaggtg
ctcttcatcggcacgctccgcgccgacgtgcccgcctgcgagcaggacgaggtgtcgcag
agcctcatcgatggattcggatgcgcacccgtgttcctccccgcggggctctacgaccga
ttctaccagcacttctgcaagggttacctatggccgctgttccactacatgctccccttc
gcctccgccttgccggcggccgcatccggcgatggccggtttgaccgcggcgcgtgggag
gcctacgtgctcgccaacaaatacttcttcgagaaggtggtcgaggtcatcaacccggag
gacgactacgtttgggtccacgattaccacctcatggcgctgcccaccttcctccgccgc
cgcttcaatcgcctccgcatcgggttcttcctccacagcccctttccctcatcggagatc
taccgctcgctgcccgtccgagaggagatcctaagaacgctgcttaattgcgatctcatt
ggattccacacattcgattatgcgaggcacttcctatcttgctgtagtaggatgctgggg
atagagtaccagtcaaagcgtggatacattggattggattactttggccgcactgttgga
atcaagatcatgccagtgggaatccatatgggtcaattgcaatcagtgttgcgattgtcc
gagaaagaaaagaaggttgctgagctgcggcagcaattcgagggcaagtccgtgttactt
ggtgtggatgatatggatatcttcaagggaatcaacttaaaacttcttgcgtttgagaat
atgctgaggacgcatcccaagtggaagggaagagctgtgttggtgcagattgcaaaccca
gcacgagggaagggaaaggatctggaggctgtccaggctgagattcgggagagttgtgat
agaattaacaaggagtttggccagtcaggttacagtccagtgattttcattgaccagagc
gtgccaagtgcggtgaggcttgcatattatacggttgctgagtgtgttgtggtgacggct
gtgagggatgggatgaatttgaccccatatgaatacattgtctgccgggaggggatacct
ggctctgagtgtgcaccagaggtgagtggaccaaagaagagcatgttggttgtgtcggag
tttattggttgctcaccttcactgagtggagccattcgtgttaacccgtggaatatcgag
gcaactgcagaggcactgaatgaggccatctcaatgtcagagcgtgaaaagcagctgagg
cacgaaaaacattaccgttatgtcagcacccatgatgttgcatattggtctaagagcttt
gtacaggacctggagagggcttgcaaggatcactttaggaaaccatgctggggcattgga
ttgggatttggcttcagggtggtagccctagacccacatttcacaaagcttaatttcgat
tcaattataatgtcctatgagagatcaaagagtagggctatatttctcgactatgatggc
acattggtgccacaggcttcgctcaacaagaatccaagtgaagaattactgaggatcatt
aataccctatgcgcagatagaaataacaccgtgttcattgtcagcgggagaagcaaggat
gacttgagcaaaaagcttatctcatgtccaaagctaggcattgccgcagagcatggctac
ttcttaaggtggactagagatgaagaatggcaaaccactgcacagacctcagattttgga
tggatgcaaatggcgaagccagtgatggatctttatactgaatcaactgacggatccacc
attgagactaaagaaactgcactggtgtggcaccatcaggatgctgaccaaggttttggc
tcttcccaggcaaaggaaatgcttgatcacttggaaagtgtattagcaaatgaaccagtc
tcagtcaagagtggccaattcattgttgaagtcaaacctcagggtgttaccaaagggctc
atagctgagaaagtactcacatcaatgaaggagaaggggcaactggcagattttgtatta
tgcattggtgatgacaggtcagatgaggatatgtttgaaaatattgccgatgtcatgaaa
aggagcattgttgcaccaaaaactccactgtttgcatgtactgtgggccagaagccaagc
aaagctaggttttacctggatgatacatttgaagtcgtcaccatgttgagttcactggcg
gatgcttcagaaccagaccttatggcagacttggaagatgacttggccacatcagtctca
tcaatagaaataagtgacagagtggtatcttttagtaatttaaggacagaaggatcttag

DBGET integrated database retrieval system