KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275860
Entry
107275860         CDS       T01015                                 
Name
(RefSeq) cell differentiation protein RCD1 homolog
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107275860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    107275860
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     107275860
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 107275860
NCBI-ProteinID: XP_015625010
UniProt: Q6K5V3
LinkDB
Position
2:11694832..11699126
AA seq 295 aa
MSTIQVPNPTDPELAQRLVLDLLDPDLRGHALAELRKKREMFPDLAPLLWHSFGTIIVLL
QEIIVVYPVLSPPTLSLLASSRVCNALALLQCVASHPETRSHFLKAHIPLYLCSFLENTS
KTRPFEYLRLTSLGVIGALVKAEGTEVINFLLQYEFVPLCLHAMAVGSELSKTVATFIIE
KIVLDDAGLGYICATADRFFAVGTALAGMVTSMDDKPSPRLLKHIIHCYLRITDNPRGLE
ALQTCLPTTLIDGTFNNLTKDDPTMQQWLQELLVKVRSGKMGGLPPPVQGHMPRV
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtcaactatccaggttcctaaccctaccgaccccgaacttgctcaacggcttgttctt
gatctgctagatccagatctcagagggcatgctctggctgaactacgcaagaaaagggag
atgtttccagatttggctccactattgtggcactcttttggcacaattattgtgctgcta
caggagattatagtagtctaccctgtcctttcacccccaacattatcattacttgcttca
agtcgagtctgcaatgcgcttgcacttcttcagtgtgttgcatcccatcccgagactagg
agccatttcttaaaagctcatattccattgtacctatgttcatttttggaaaataccagc
aagaccagaccttttgaatacttgcggctgaccagcttgggtgtcattggtgctcttgtg
aaggctgaaggtacagaagtcatcaattttctactgcaatatgaatttgttcctctctgc
ctgcatgccatggcggtaggcagtgagctttcaaaaactgtggcaacttttattattgaa
aagattgtcttggatgacgctgggcttggttacatttgcgctactgctgatcggttcttc
gctgtggggactgccttagcaggcatggtgacctcaatggatgacaagccctccccaagg
ttgttgaagcacattatccactgttaccttaggatcacagacaatcctaggggcttggag
gcactgcagacttgccttcctaccacacttatagatgggacattcaacaatcttactaag
gatgaccctacaatgcagcaatggctccaagaactgttggtcaaagtgaggagtggaaaa
atgggaggactacctcctccagttcaaggtcacatgccgagggtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329079
Entry
4329079           CDS       T01015                                 
Name
(RefSeq) cell differentiation protein rcd1 isoform X1
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329079
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329079
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4329079
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 4329079
NCBI-ProteinID: XP_015623768
LinkDB
Position
2:complement(11339961..11346841)
AA seq 315 aa
MLTSEVPSPRDPELVERLILDLLDPELKRHAPSELRKKREMFQNLALLLWNSFGIVASLL
QVFSKKVVLMSATLSNSTLAQEIIVVYPALSPPTLSLGASNRVCNALALLQCIASHSETR
THFLQARIPLYLCAFLETDDKAKQFEYLRLTSLGVIGALVKVDDPKIINFLLENEFVPLC
LHNMTIGSELSKTVATFITEKIVVDDAGLAYVCANADRFYAVGAALATVVTSMVDQPSKR
LLKHVIRCYLRMSENPRGFAALQTCLPPQLKDGTFNSCLRDDPSGRHLHQQLLVKMTSGK
KGGGAGNSAGRMSWG
NT seq 948 nt   +upstreamnt  +downstreamnt
atgttgactagtgaggttcctagccctagagaccctgaacttgttgagcgtcttattctt
gatttgctagatccagaactcaaacgacatgctccttccgagctacgcaagaaaagagag
atgtttcaaaacctggctctgctgttgtggaattcttttggcatagttgcttcactgctc
caggtcttctccaaaaaggtggttttgatgtcagccactcttagtaattcaacattagca
caagagattatagtagtctaccctgcactttcacccccaactttgtcattaggtgcttca
aaccgagtttgcaatgcactagcacttcttcagtgtattgcttcacattcggagactagg
acccatttcttacaagcccgcattccgttgtacctatgtgcatttttggaaactgatgac
aaggccaaacaatttgagtacttgcggttgaccagcttgggtgtcattggcgctcttgtt
aaggttgatgatccaaaaattatcaattttctgctggaaaatgaatttgttcctctatgc
ctgcataatatgacgatcggcagtgaattatcaaaaactgtggcaacttttatcactgaa
aaaattgtcgtagatgacgccggtctagcttatgtttgtgccaatgctgatcggttctat
gctgtgggagctgctttagcaaccgtggttacctcaatggttgatcagccttccaagagg
ttgctgaaacacgttatccgttgttacctcaggatgtcagagaatcctaggggtttcgct
gcactgcagacttgccttcctcctcagctgaaagatggcacattcaacagctgtcttagg
gatgatccttcagggcgacatttgcaccaacaactgctggttaagatgacaagtggaaaa
aagggaggaggagctggtaacagcgctggtcgtatgtcatggggataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336974
Entry
4336974           CDS       T01015                                 
Name
(RefSeq) cell differentiation protein RCD1 homolog
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4336974
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4336974
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4336974
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 4336974
NCBI-ProteinID: XP_015633530
UniProt: Q0JA69 A0A0P0WEP8
LinkDB
Position
4:complement(31098559..31103195)
AA seq 326 aa
MANLQPSLSIPPSFAGASPPSPSPIGGGGVGGGVGQPAKDMKMASAEQLVLDLCDPELRE
NALLELSKKREIFQDLAPLLWHSFGTVAALLQEIVSIYSALSPPTLSPGASNRVCNALAL
LQCVASHPETRILFLTAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDDTEVIS
FLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLRYICATAERFFAVGSVLANM
VVSLAEQPSTRLLKHIIRCYLRLSDNSRACAALQTCLPDMLKDGTFNNCLRDDPTTRRWL
QQLLLNVTGAGMGAAPQPGLDHMMGI
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcgaatctgcagccctcgctttccattccgccctccttcgccggggcctcgccgcca
tcgccttctccgatcggcggcggtggcgtgggcggcggggtggggcagccagccaaggat
atgaagatggcgtcggcggagcagctggtgctcgacctctgcgaccccgagcttcgcgag
aacgccctcctcgagctctcgaagaaaagagagatatttcaagatctggccccacttctt
tggcattcttttggaacagttgctgcacttcttcaggaaattgtgtcaatctactctgca
ctttcacccccaacattgtcaccaggtgcatcgaaccgagtctgcaatgcacttgcactt
cttcagtgtgttgcatctcaccctgagaccaggatccttttcttaactgctcatattccc
ctgtacctgtacccattcttgaatactaccagcaagacaagaccttttgaatacctgcga
ctcaccagcctgggtgtcatcggtgcacttgttaaggttgatgatactgaagttatcagt
tttctgctgcaaactgaaataattcctctgtgtttgcgtaccatggaaatgggaagtgag
ctgtcaaaaactgtggccaccttcattgttcagaagattctcctcgatgatgttggattg
cgctacatttgtgccactgctgagcgtttctttgctgtaggcagtgttttagcaaacatg
gtggtttcacttgctgagcagccttccacaaggttgctgaagcacattatccgatgttac
cttaggctgtcagacaattccagggcatgtgctgcactacaaacttgcctccctgacatg
ctgaaggatggcacgttcaataactgtcttagggatgatcctacaacaaggcgctggctc
cagcaattgcttcttaatgtgacaggcgcaggcatgggagctgctcctcagccaggcctg
gatcacatgatggggatataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343622
Entry
4343622           CDS       T01015                                 
Name
(RefSeq) cell differentiation protein RCD1 homolog
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4343622
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4343622
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4343622
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 4343622
NCBI-ProteinID: XP_015644592
UniProt: Q0JA69 A0A0P0WEP8
LinkDB
Position
7:22659388..22664105
AA seq 326 aa
MANLQPSLSIPPSFAGASPPSPSPIGGGGVGGGVGQPAKDMKMASAEQLVLDLCDPELRE
NALLELSKKREIFQDLAPLLWHSFGTVAALLQEIVSIYSALSPPTLSPGASNRVCNALAL
LQCVASHPETRILFLTAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDDTEVIS
FLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLRYICATAERFFAVGSVLANM
VVSLAEQPSTRLLKHIIRCYLRLSDNSRACAALQTCLPDMLKDGTFNNCLRDDPTTRRWL
QQLLLNVTGAGMGAAPQPGLDHMMGI
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcgaatctgcagccctcgctttccattccgccctccttcgccggggcctcgccgcca
tcgccttctccgatcggcggcggtggcgtgggcggcggggtggggcagccagccaaggat
atgaagatggcgtcggcggagcagctggtgctcgacctctgcgaccccgagcttcgcgag
aacgccctcctcgagctctcaaagaaaagagagatatttcaagatctggccccacttctt
tggcattcttttggaacagttgctgcacttcttcaggaaattgtgtcaatctactctgca
ctttcacccccaacattgtcaccaggtgcatcgaaccgagtctgcaatgcacttgcactt
cttcagtgtgttgcatctcaccctgagaccaggatccttttcttaactgctcatattccc
ctgtacctgtacccattcttgaatactaccagcaagacaagaccttttgaatacctgcga
ctcaccagcctgggtgtcatcggtgcacttgttaaggttgatgatactgaagttatcagt
tttctgctgcaaactgaaataattcctctgtgtttgcgtaccatggaaatgggaagtgag
ctgtcaaaaactgtggccaccttcattgttcagaagattctcctcgatgatgttggattg
cgctacatttgtgccactgctgagcgtttctttgctgtaggcagtgttttagcaaacatg
gtagtttcacttgctgagcagccttccacaaggttgctgaagcacattatccgatgttac
cttaggctgtcagacaattccagggcatgtgctgcactacaaacttgcctccctgacatg
ctgaaggatggcacgttcaataactgtcttagggatgatcctacaacaaggcgctggctc
cagcaattgcttcttaatgtgacaggcgcaggcatgggagctgctcctcagccaggcctg
gatcacatgatggggatataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272009
Entry
9272009           CDS       T01015                                 
Name
(RefSeq) cell differentiation protein RCD1 homolog
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9272009
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9272009
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     9272009
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 9272009
NCBI-ProteinID: XP_015629837
UniProt: Q10CF3 A0A8J8YK26
LinkDB
Position
3:complement(32570053..32576109)
AA seq 330 aa
MANLPPSLSIGAASFAAPSPPPPSPGASSSSSAAAAAAPGAAKDRKMASAEQLVLDLCDP
ELRENALLDLSKKREIFQDLAPLLWHSYGTIAALLQEIVSIYPSLSPPTLSPGASNRVCN
ALALLQCVASHSDTRIPFLNAHIPLYLYPFLNTTSKTRPFEYLRLTSLGVIGALVKVDDS
EVIGFLLQTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLRYICATAERFFAVASV
LSQMVQALADQPSPRLLKHIIRCYLRLSENSRACTALNSCLPNALKDGTLNNFLQDDHVT
RRWLQQLLHNMTMAGMGGAPHGGLDHIMGM
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcgaatctgccgccgtcgctctccatcggcgccgcctccttcgccgcgccctcgccc
ccgccgccctcgcctggcgcctcctcgtcgtcgtcggcggcggcggcggcggctccgggg
gccgccaaggaccggaagatggcgtccgcggagcagctcgtgctcgacctctgcgacccc
gagctgcgggagaacgccctcctcgacctctccaagaagcgagagatttttcaggatctt
gctccactcctgtggcactcttatggaacaattgctgcactactccaggagattgtgtca
atctatccatcactttcacccccaacattatctccaggggcttcaaaccgtgtctgcaat
gcacttgcacttcttcagtgtgttgcctcacacagtgacacaaggattcctttcttgaat
gctcacatcccactgtatctgtaccctttcttgaatactactagcaagacaaggcctttt
gagtacttgaggcttaccagcttgggtgtcattggcgcacttgtgaaggttgatgattct
gaagtcattgggtttctgctgcaaactgaaataattcctctgtgtctccgtactatggag
atgggcagtgaactttcgaaaacggttgccacctttattgttcaaaagattctgcttgat
gatgttgggcttcgctacatatgtgctactgctgaacgtttctttgccgtagccagtgtt
ctatcacagatggttcaggcacttgctgatcaaccttctccaagactgctgaagcacata
attcgctgctacctcaggctgtcagaaaattccagggcatgtaccgcgctgaacagctgc
ctccccaacgcgctgaaagatggaaccctcaacaacttcctccaggatgatcatgtcaca
aggcgttggctccagcagctgctgcacaacatgactatggccggcatgggaggagctcct
catggaggccttgatcacatcatggggatgtga

DBGET integrated database retrieval system