KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275880
Entry
107275880         CDS       T01015                                 
Name
(RefSeq) 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    107275880
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     107275880
SSDB
Motif
Pfam: Pantoate_transf PEP_mutase
Other DBs
NCBI-GeneID: 107275880
NCBI-ProteinID: XP_015645815
UniProt: Q9AWZ7
LinkDB
Position
1:complement(6912704..6915139)
AA seq 399 aa
MSFSRLLTPRILLDTTAVFPPSSSVVAPSLSRQLRCTRTGGSPPAPPHRLVARRAMSNGA
AEPAIYGGGGGAQQAASSAAARRVTLATLRGKHRRGEPISMVTAYDYPSGVHVDAAGFDI
CLVGDSAAMVAHGHDNTLPISLDLMIEHCRAVARGAARTFLVGDLPFGSYEASTAQAVGS
AVRVMKEGGVNSIKLEGSAPSRISAARAIVDAGIAVMGHIGLTPQSVSALGGFRPQGKTV
ESAVKVVEAALALQEAGCFAVVLECVPAPVAAAATSALTIPTIGIGAGPFCSGQVLVYHD
LLGTFQTSHAKVSPKFCKQYGNIGDVINRALSKYKQEVETQSFPGPSHTPYKLAATDVDA
FLNALKMKGLNVAADAAADAVEYTDEKEINGTPQLKVYA
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgtctttctcccgcctcctaaccccaagaattctcctggacaccaccgccgtgttcccg
ccaagcagcagcgtcgtcgccccgtcgctctcccgccaactgcggtgcacgcgcacgggt
gggtcgccgccggcgccgccgcataggctcgtggcgcggcgggcgatgagcaacggggcg
gcggagccggccatctacggcggcggcggcggcgcacaacaggcggcgtcgtctgctgcg
gcgcggcgcgtgacgctggcgacgctccgcgggaagcaccggcgcggggagccgatcagc
atggtgaccgcctacgactacccgtccggggtgcacgtcgacgccgccgggttcgacatc
tgcctcgtcggcgactccgccgccatggtcgcgcacggccacgacaacaccctccccatc
tccctcgacctcatgatcgagcactgccgcgccgtggcgcgcggcgcggccaggacgttc
ctcgtcggcgacctcccgttcggcagctacgaggcctccaccgcacaggctgtcggctcg
gcggtgagggtgatgaaggaaggcggcgtgaattcaatcaagctggaagggagcgcgccg
tcgaggatcagcgcggcgagggccatcgtggacgccgggatcgccgtgatggggcacatc
gggctcacgccgcagtccgtcagcgcgctcggcgggttccggccacaggggaagacggtc
gagagcgccgtcaaggtcgtggaggcggcgctcgcgttgcaggaggccggctgcttcgcc
gtcgtgctggagtgcgtgccggctccggtggcggcggcggcgacttcggcactgacaatc
ccgaccattggcatcggcgccgggccattctgcagcgggcaggtcttagtctaccacgac
ttgttagggacgttccaaacaagtcatgccaaggtctcgccaaaattctgtaaacagtat
ggtaacattggggacgtgattaacagagctctatcaaagtacaagcaagaggtggaaacc
cagtcttttccgggtcctagtcacacgccctacaaactagctgccacagatgttgatgcc
tttctgaatgcgctgaagatgaagggcctgaatgtggctgctgatgctgcagccgatgct
gttgaatatacagatgagaaagagataaatggaacgccgcagctcaaggtctatgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326739
Entry
4326739           CDS       T01015                                 
Name
(RefSeq) 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4326739
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     4326739
SSDB
Motif
Pfam: Pantoate_transf PEP_mutase
Other DBs
NCBI-GeneID: 4326739
NCBI-ProteinID: XP_015629790
UniProt: Q9AWZ8
LinkDB
Position
1:complement(6909713..6912241)
AA seq 364 aa
MMMMMRRAFRHLARQQRRPLSHVPESAVYGGPRPQDVGAAAGAGAGAGATRRVTVTTLRG
KHRRGEPITVVTAYDYPSAVHVDSAGIDVCLVGDSAAMVVHGHDTTLPISLDVMLEHCRA
VARGATRPLLVGDLPFGCYESSSTRAVDSAVRVLKEGGMDAIKLEGGAPSRISAAKAIVE
AGIAVMGHVGLTPQAISVLGGFRPQGKTVDSAVKVVETALALQEAGCFSVVLECVPAPVA
AAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFGNVGHVINKA
LSEYKQEVETRSFPGPSHTPYKIAAADVDGFANALQKMGLDEAANAAAAAAENAEKDGEL
PENK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgcggcgggcgttccggcacctggcgcggcagcagcggcggccgctg
agccacgtgccggagtcggccgtctacggcgggccgcggccgcaggatgtgggggcggcg
gcgggagcgggggcgggggcgggggcgacgcggcgggtgacggtgacgacgctccgcggg
aagcaccgacgcggggagcccatcaccgtcgtcacggcctacgactacccgtccgcggtg
cacgtcgactcggccgggatcgacgtctgcctcgtcggggactcggcggccatggtggtg
cacggccacgacaccacgctccccatctcgctcgacgtcatgctcgagcactgccgcgcc
gtcgcccgcggcgccaccaggccgctcctcgtcggcgacctccccttcggttgctatgag
tcctcctccacgcgggctgttgactctgcggtgagggtgctaaaagaaggtggaatggac
gcaatcaagctggaaggaggtgcaccctcgagaatcagtgcggctaaggctattgtggag
gctggaatcgctgtaatggggcatgttgggctcacgccgcaggctattagcgtgcttggt
ggatttcgaccacaaggaaagacggttgatagtgctgtgaaggttgtggagacagcactt
gccttgcaggaggctggctgcttctcggttgtgttggagtgtgtgccagctcctgtggca
gctgctgcaacatcagcattgcaaatcccaaccattggaattggtgctggaccattctgc
agtggacaggtcttagtttaccatgacttgttagggatgatgcaacatccacaccatgcc
aaggtcacaccgaaattctgcaaacaatttggaaatgtcggtcatgtcatcaacaaggct
ctatcggagtacaagcaggaagtggaaacccggagtttcccaggtcccagccatacgccg
tacaagatagctgccgcggatgtggatggcttcgcgaatgcactgcagaagatgggcttg
gacgaggctgcaaatgctgcagctgccgcagctgaaaacgcagagaaagatggagaacta
cccgagaacaaatga

DBGET integrated database retrieval system