KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275959
Entry
107275959         CDS       T01015                                 
Name
(RefSeq) glycerol-3-phosphate acyltransferase 1-like
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107275959
   00564 Glycerophospholipid metabolism
    107275959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    107275959
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     107275959
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     107275959
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   107275959
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 107275959
NCBI-ProteinID: XP_015649175
UniProt: A0A0P0XBI0
LinkDB
Position
8:complement(1757369..1759259)
AA seq 427 aa
MTFVSTAGLSVADVAAVARATLPRFFLADLSDAAFRAFARRDAAERYVVTRLPTAMVEPF
VREYVAEGARVVGAELRVVGGRFTGAAVNGDRSLGALQAVLGRGRRVIDVGLCSGDGAAK
RQPAFMKICQERHVVSTPEKAPAAPLPRSEYLRPLIFHDGRLVGRPDPLACLAVALWLPL
GAALAVTRILIAFLPYSVGLLLAAATGFQIRAHLGGAPPRWRGGTLYACNHRTLLDPAVL
STVVHRKVTAVTYSLSGLSEMIAPIPTVRLTRDRGRDRVIMQSVLAGGDLAVCPEGTTCR
EPYLLRFSPLFAEIAGEVTPVAVRAGGAMFHGTTVRGYKGMDSFFFLMNPAPWYHLQLLD
PVPSSSAAADGDGGGDGGGESSRDVANRVQRAIGDALGFECTALTRRDKYRMIAGHDGVD
MRGNARL
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaccttcgtgtccaccgccggcctctccgtcgccgacgtggcggcggtggcgagggcc
acgctgcccaggttcttcctcgccgacctcagcgacgccgcgttccgggccttcgcgcgc
cgcgacgccgccgagaggtacgtcgtgacgcggctgccgacggccatggtggagccgttc
gtccgggagtacgtcgccgagggagcccgcgtcgtcggggcggagctgcgggtggtcggg
gggcggttcaccggcgcggcggtgaacggcgaccggagcttgggcgctctgcaagccgtt
cttgggcgcggccgccgggtcatcgacgtcgggctgtgctccggcgacggcgcggcgaag
cggcagccggcgttcatgaagatatgccaggagcgccacgtggtgtccacgccggagaag
gcgccggcggcgcctcttccgaggagcgagtacctccggccactgatcttccacgacggc
cgcctcgtcggccggccggacccgctggcctgcctcgccgtcgcgctctggctcccactc
ggcgccgccctcgccgtgacacgcatcctcatcgccttcttgccctacagcgtcggcctc
ctcctcgccgcggccaccggcttccagataagagcgcacctcggcggcgcgccaccgcgg
tggcgagggggcacgttgtacgcgtgcaaccaccggacgctgctggacccggcggtcctc
tcgacggtggtgcaccggaaggtgaccgccgtgacgtacagcctctccggcttgtcggag
atgatcgcgccgatcccgacggtgcggctgacgcgcgaccgcggcagggacagggtgatc
atgcagtccgtgctcgccggcggcgacctcgccgtctgcccggagggcaccacgtgccgg
gagccgtacctgctccggttcagccccctgttcgcggagatcgccggcgaggtcacgccg
gtggccgtgcgggccggcggcgccatgttccacggcacgacggttagggggtacaagggg
atggactccttcttcttcctcatgaacccggcgccgtggtaccatctgcagctgctcgac
ccggtgccatcctcttctgccgccgccgacggtgatggcggcggtgacggcggcggcgag
tcgagccgcgacgtggcgaaccgcgtgcagcgagcgatcggcgacgccctcggattcgag
tgcacggcgctgacgcgcagggacaagtaccggatgatcgccggccacgacggcgtcgac
atgcgcggcaacgcccgcctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324826
Entry
4324826           CDS       T01015                                 
Name
(RefSeq) glycerol-3-phosphate 2-O-acyltransferase 6
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4324826
   00564 Glycerophospholipid metabolism
    4324826
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324826
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4324826
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4324826
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4324826
SSDB
Motif
Pfam: HAD Acyltransferase
Other DBs
NCBI-GeneID: 4324826
NCBI-ProteinID: XP_015622145
UniProt: A0A0P0VAG7 Q5N7U2
LinkDB
Position
1:complement(36863031..36871097)
AA seq 497 aa
MVSRRFKPVEECSSDGRSEQTVAADFDGTLVRSRSAFPYYLLVALEAGSVLRAVVLLLSV
PFVYVTYIFFSESLAISTLVYISVAGLKVRNIEMVARSVLPKFYAEDVHPESWRVFNSFG
KRYIITASPRIMVEHFAKTFLGADKVVGTELEVGKNGKATGFMVKPGVLVGDHKRQAVVK
ELRDAVPDVGLGDRETDFDFMSICKEAYLVTSRKYSAVPKNQLLSPLILHDGRLVQRPTP
LVALVTFLWMPFGFALALLRVYVNLPLPERIVFYTYKLMGIRLIVKGNPPPPPKKGHPGV
LFVCNHRTVLDPVEVAVALRRKVSCVTYSISKFSELISPIKAVALSREREKDAENIRRLL
EEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKESMFHGSTVRGFKLMDPYF
FFMNPRPTYEITFLNQLPKELTCSGGKSPIEVANYIQKTLSGQLGFECTAITRKEKYSIL
AGTDGRVPSKNKEKEKN
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgtcgcggaggttcaagcccgtggaggagtgcagctcggatgggaggtcggagcag
acggtggccgccgacttcgacggcacgctggtcaggtcgcggagcgccttcccgtactac
ctcctcgtcgcgctcgaggccggcagcgtgctccgcgccgtcgtgctgctgctgtccgtg
ccgttcgtctacgtgacctacattttcttctccgagtcgctggccatcagcacgctggtg
tacatctccgtggcggggctcaaggtgaggaacatcgagatggtggcgcggtcggtgctg
cccaagttctacgcggaggacgtgcacccggagagctggagggtgttcaactccttcggc
aagcggtacatcatcacggcgagccccaggatcatggtggagcacttcgccaagacgttc
ctcggcgccgacaaggtggtcgggacggagctggaggtcggcaagaacggcaaggccacg
gggttcatggtgaagcccggagtgctcgtgggcgaccacaagaggcaggccgtcgtcaag
gagctacgcgacgcggtgcccgacgtcggcttgggcgacagggagacggatttcgacttc
atgtccatatgcaaggaggcctacctcgtgacatcaaggaagtacagcgcggtgcccaag
aaccagctgctgagcccactcatcctccacgacggccgcctcgtgcagcgtccgacgccg
ctggtggcgctcgtcaccttcctgtggatgccgttcggcttcgcgctcgcgctcctccgc
gtgtacgtcaacctgccactcccggagcggatcgtcttctacacctacaagctcatgggc
atccgcctcatcgtgaagggcaacccgccgcctccccccaagaagggacatcctggcgtc
ctcttcgtctgcaaccaccgcaccgtgctcgacccggttgaggtcgccgtggcgctgcgc
cgcaaggtcagctgcgtcacgtacagcatctccaagttctcggagctcatctcgccgatc
aaggccgtcgcgctgtcgcgggagcgcgagaaggacgccgagaacatccggcggctgctg
gaggagggcgacctggtgatctgccccgagggcaccacctgccgcgagccgttcctgctg
cggttcagcgcgctcttcgccgagctcaccgaccgcatcgtgccggtggcgatcaacacc
aaggagagcatgttccacggctccaccgtgcggggcttcaagctcatggacccctacttc
ttcttcatgaacccgcggccgacgtacgagatcaccttcctgaaccagctgcccaaggag
ctcacttgcagcggcggcaagtcgcccatcgaggtggccaactacatccagaagacgctc
agcggccagctcggcttcgagtgcaccgccataacgcgcaaggagaagtacagcatactc
gccgggaccgacggccgcgtcccttccaagaacaaggagaaggaaaagaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326672
Entry
4326672           CDS       T01015                                 
Name
(RefSeq) glycerol-3-phosphate acyltransferase 1
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4326672
   00564 Glycerophospholipid metabolism
    4326672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4326672
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4326672
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4326672
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4326672
SSDB
Motif
Pfam: HAD Acyltransferase
Other DBs
NCBI-GeneID: 4326672
NCBI-ProteinID: XP_015634691
LinkDB
Position
1:25256990..25263976
AA seq 544 aa
MVLPTILPKIAAHWLFTFYRAARKLRGHAFQYCRSSSATTTKPPPPSPVSPAAKCTVVFP
DAADKAVVFGFDGALMRSAALFPYFMLVACEGGSLLRALLLLCAFPLVWALGERSDAGVR
VMAFVTFFGLRPRDMDLVARAVLPKFYMEGLNAQVYSRLWLPARRKVVVTGAPRVMVEWF
LKEYMAADVVVGGELHVVRVGRGRYFTGMLCGPGGSAAPALKHKALQAEALGTDNAMADV
AVVGNASQLDHPCFPYCKEVYVVNRESTKTARLPRDRYPKPLIFHDGRLAFLPTPSAALA
FFLFLPLGVILSVIRISIGILLPYKISFGAGALFGVRYRTSGLRAPEPGVKRRGVLYVCT
HRTLVDPIMLTAALQKPVPAVTYSLSRLSEVIAPIKTVRLTRDRERDAETMSRLLEHGDL
AVCPEGTTCREPYLLRFSPLFAELADDMEPVALDAQVTTLYGTTASGHKWLDPVVFFANP
QPAYRVDFLGAVPREWTRAGGRAGAEVANWVQRRLGEALGYECTGLTRRDKYMMLAGNDG
VVAK
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggtgcttccaaccatcctccccaagatagccgcgcactggctcttcaccttctaccgc
gcggcacgtaagctccgcggccatgcgttccagtactgccgcagctcctccgccactact
accaagccgcctccgccgtcgcccgtctcgccagcggccaagtgcaccgtcgtcttcccc
gacgccgccgacaaggccgtggtgttcggcttcgacggcgcgctcatgaggtccgcggcg
ctcttcccctacttcatgctcgtcgcctgcgagggcggcagcctgctgcgcgctctgctc
ctgctctgcgccttccctctcgtctgggcccttggcgagcgctccgacgccggcgtcagg
gtcatggcgttcgtcaccttcttcgggctgaggccccgcgacatggacctcgtggcccgc
gccgtcctgcccaagttctacatggaggggctcaacgcgcaggtgtacagccgcctctgg
ctgccggcgaggaggaaggtggtggtgacgggcgcgccgagggtgatggtggagtggttc
ttgaaggagtacatggccgccgacgtggtggtcggcggcgagctgcatgttgttagggtt
ggtcgcggccgctacttcaccgggatgctgtgtgggccaggaggatcggcggcgccggcg
ctgaagcacaaggccctgcaggcagaggcgttgggaacggacaacgccatggctgacgtg
gccgtcgtcgggaacgccagccagctcgaccacccctgcttcccatactgcaaggaagtt
tacgtcgtgaacagggagagcaccaagaccgcgcggctgccgcgggacaggtacccgaag
ccgctcatcttccacgacggccgcctcgccttcctcccgaccccctccgccgcgctcgct
ttcttcctcttcctccccctcggcgtcatcctctccgtcatccgcatctccatcggcatc
ctgctcccctacaagatcagcttcggggccggcgccctcttcggcgtccgctaccgcacg
tcgggcctccgcgccccggagcccggcgtcaagcgcaggggcgtcctgtacgtgtgcacg
caccggacgctggtcgacccgatcatgctcaccgccgcgctccagaagcccgtgccggcc
gtgacgtacagcctcagccggctgtccgaggtcatcgcgcccatcaagacggtgcggctg
acgcgcgaccgcgagcgcgacgccgagacgatgtcgcggctgctggagcacggcgacctc
gcggtctgccccgagggcaccacctgccgcgagccgtacctgctgcggttcagcccgctg
ttcgcggagctggccgacgacatggagcccgtggcgctggacgcgcaggtgacgacgctg
tacggcacgacggcgagcggccacaagtggctggaccccgtggtgttcttcgccaacccg
cagcccgcgtaccgggtggacttcctgggcgccgtgccgcgggagtggacccgcgccggt
ggcagggccggcgccgaggtggcgaactgggtgcagcggcgtctcggcgaggcgctcggg
tacgagtgcaccgggctgactcgccgcgacaagtacatgatgctcgccggcaacgacggt
gtggtcgccaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326728
Entry
4326728           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate acyltransferase 3
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4326728
   00564 Glycerophospholipid metabolism
    4326728
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4326728
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4326728
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4326728
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4326728
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 4326728
NCBI-ProteinID: XP_015627625
UniProt: Q5JNP7
LinkDB
Position
1:complement(10969118..10973289)
AA seq 545 aa
MASDPSSGHTNFYRFVRRWLANPLGHHQHHHLRRSTSTGISSSTYPRIIPRCPSSSSSAQ
DRDRLRDKTMILDVEGGILMSSSTFPYFMLVAMEAGGFLRGFIMLCVHLVLWCLAPLLPE
EVKLKVMVMVCFFGLKEKKVARVARAALPKHFLEGVGMEGLEAVRGVKSVVGVSRVIPRV
MVKPFLEDYLGVDVVVGREVKMVRGFYVGLLENMSDGRLELADLEGEEMIGFGSSSGYSG
HDHHHLFSWCKEVYLVTPEEKRKWSPLPRDQYPKPLVFHDGRLAFRPTFQATLAMLTWLP
FSLPLTIFRTLIFVTLPYPVSVAIGSVFGVRTRVINSPVGQAKADHPRNPKGHLYVCNHR
TLLDPVYIAAMLNKKVSAVTYSVSRLSEWISPIPTIRLTRDRDEDRRRMEEALRRGDLVV
CPEGTTCREPYLLRFSPLSLELVDEVYLVALVNWSDMFYGNSTGRSKCLDSFYYFMNPRP
AYDVEFMEKVPTRMVVDGKTCESKHVANMVQGEIGRVLGFECTKFTRENKYLALAGNRGV
VDANQ
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcatcagatccctcctccggccacactaatttctaccgatttgttcgccggtggctg
gcaaatccgctaggtcaccaccagcaccatcatctccggcgaagcaccagtactgggatc
tcatcatcaacctaccctaggatcatcccaagatgcccatcatcatcatcatcggcgcaa
gaccgggatcgccttcgagacaagacgatgatcctagatgtagaaggagggatcctaatg
tcatcttctaccttcccttacttcatgcttgtggccatggaggcaggtggtttcctcagg
ggcttcatcatgctatgcgtccaccttgtcctgtggtgcctggcgccgctgctgccggaa
gaggtgaaattgaaggtcatggtgatggtgtgcttctttgggttgaaggagaagaaggtg
gctagggttgcgagggcggcgctgccgaagcacttcctagagggtgtaggaatggaaggg
cttgaggctgtgagaggggtgaaaagtgtggtaggggtgagcagggtgatccctagggtt
atggtgaaaccattcctggaagattacctaggtgtggatgtggttgtggggagagaggtg
aagatggtaagaggtttttatgttggtttattggagaacatgagtgatggaaggttagag
ctggcagatctggaaggagaagaaatgatagggtttggaagcagctcaggatattctggc
catgatcaccaccatcttttctcttggtgcaaggaggtttacctggtgactccagaagaa
aaacgaaaatggtcacccttgccaagagaccagtaccccaagcccttggtcttccatgat
ggaaggctggccttcaggccaacctttcaagccaccctagccatgttaacatggctccca
ttttccctccccctcaccatcttcagaacactcatctttgtcaccctcccctaccctgtt
tctgtggcgatcggatccgtattcggagtcagaacccgtgtcatcaactcccctgttggt
caggccaaagctgatcacccaagaaacccaaaggggcacctctacgtgtgcaaccaccgg
acgctgctcgacccggtctacattgcagcgatgctcaacaagaaggtctcggccgtcacc
tacagcgtcagccgcctcagcgagtggatatcgccgatcccgaccatccggctgacccgg
gatcgcgacgaggaccggaggaggatggaggaggcgctgcggcggggcgacctggtggtc
tgccccgaggggacgacctgccgcgagccctacctcctccggttcagcccgctgtcgctg
gagctcgtcgacgaggtctacctggtggctctggtgaactggtccgacatgttctacggc
aactccaccggaagaagcaagtgcctggacagcttctactacttcatgaatccgcgcccg
gcttacgatgtcgagttcatggagaaggtgccaaccaggatggtcgtggatggcaagacc
tgtgagagcaaacatgtggccaacatggtgcagggtgagattggtagagtgcttgggttt
gaatgcaccaagttcacccgtgagaataagtacctggcgctggcaggaaatagaggggtt
gttgatgcaaaccagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326982
Entry
4326982           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate acyltransferase 3
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4326982
   00564 Glycerophospholipid metabolism
    4326982
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4326982
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4326982
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4326982
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4326982
SSDB
Motif
Pfam: HAD Acyltransferase
Other DBs
NCBI-GeneID: 4326982
NCBI-ProteinID: XP_015646126
LinkDB
Position
1:complement(12677055..12683552)
AA seq 558 aa
MTKVFTRSLLMYFNKIVRSLRPLVHSPPPQPAAADNIVRWPSDDELLPAPDTTTTSVVTT
VCKVEGGLLMSPSTFPYFMLVALEAGGGGGGLLRGLLLLLLYPALRLLGHDRAIRVMAMV
SFAGVRKDGFRLGSSTLPRLLLEDVSAEVFEAAVRRRRCVCVSGMPREMVEPFLREYLGV
DAVVAPEVRAFGGYYLGLMESDGEVLRRLDMEEVIGGGEKEETCGDGDGRVVVGIGGRGR
SFSRIFQKYCKEVYVATKSARRRWRPLHPRRYAKPLIFHDGRTAFRPTAAATLAMFMWLP
LGAPLAILRTAVFLLLPFSISVPLLAALGMHSRRISSSSLPPAAAAAHNLFVCNHRSLVD
PLYVSAATGRTDLSAATYSISRLSEILAPIRTFRLTRDRATDRAAMQAHLSLPGGGGGGL
VVCPEGTTCREPFLLRFSPLFTELGADVQPVALHSAVSMFHGTTAGGWKLLDPLYLLMNP
TPAYVVQLLDPVAVGGEGGGGGPELANEVQRRIAEALGYTRTALTRRDKYLALTGNDGGV
DRRRVAGSHHHQEGVLNG
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgactaaggtcttcaccaggtctctcctaatgtacttcaacaagatcgtcaggagcctc
agacccctcgtccattcgccgccgccgcagccggcggcggcagacaacatcgtccggtgg
ccgtcggacgacgagctgctgccggcgccggacaccaccacgacgagcgtcgtcaccacc
gtgtgcaaggtggagggcggcctgctgatgtcgccgtccactttcccgtacttcatgctc
gtcgccctggaggcaggaggtggcggcggcggcctcctccgcggcctcctgctcctgctg
ctctacccggcgctgcgcctgctcggccatgaccgggcgatcagggtcatggccatggtg
agcttcgccggcgtgaggaaggacgggttccggctgggcagctcgacgttgcccaggctg
ctcctggaggacgtgagcgccgaggtgttcgaggctgcggtgcggcggcggcggtgcgtg
tgcgtgagcggcatgccgagggagatggtggagccgttcctgagggagtacctcggcgtc
gacgccgtcgtcgcgccggaggtgagggcgttcggcgggtactacctcggtctcatggag
tccgacggcgaggtgctccggaggctggacatggaggaggtgatcggaggtggggagaag
gaggagacgtgcggcgacggcgatggccgcgtcgtcgtcggcattggtggacgtgggaga
tcgttcagtcggatctttcaaaagtattgcaaggaggtgtacgtggcaaccaagtcggcg
cggcggcggtggcgccccctccatccccggcgctacgcgaagcctctcatcttccacgac
ggccgcactgcattccggccgacggcggccgcgacgctcgccatgttcatgtggctgccg
ctgggcgcacccctcgccatcctccgcaccgccgtcttcctcctcctccccttctccatc
tccgtgccactcctcgccgccctaggcatgcacagccgccgcatctcctcctcctcgttg
ccgccggcggcggcggcggcgcacaaccttttcgtctgcaaccaccgctccctggtcgac
ccgctctacgtctccgccgccaccggccgcaccgacctctccgccgccacctacagcatc
agccgcctctccgagatcctggcgcccatccgcaccttccgcctcacccgcgaccgcgcc
accgaccgtgccgccatgcaggcccacctgtccctccccggcggcggcggcggcgggctg
gtggtgtgccccgagggcaccacctgccgggagccgttcctgctgcggttcagcccgctg
ttcacggagctcggcgccgacgtgcagcccgtggcgctgcactcggcggtgtccatgttc
cacggcacgacggcgggggggtggaagctgctcgacccgctctacctgctcatgaacccc
acgccggcctacgtcgtgcagctcctggatcccgtcgccgtcggaggcgagggcggcggc
ggcggaccggagttggcgaacgaggtgcagcggcggatcgcggaggcgctggggtacacg
cgcacggcgctgacgaggagggacaagtacctcgccctcaccggcaacgatggcggcgtc
gatcggcgccgcgtcgccggcagccaccaccatcaagagggagtacttaatggttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327112
Entry
4327112           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate acyltransferase 3
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327112
   00564 Glycerophospholipid metabolism
    4327112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4327112
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4327112
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4327112
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4327112
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 4327112
NCBI-ProteinID: XP_015637172
UniProt: Q7F8E3 Q9SNF7
LinkDB
Position
1:8347782..8350998
AA seq 518 aa
SSSPLELDRLYGRTVVVDVDAWLLLPAVDAFTFFMVVAVEAGGFLRGLLLLLVYPLLCLL
LGDGDGGGGARARAMATVALVGLEEREVARVGRAVMPRFLMAAAAAEGAEAVRAARRSVA
VSATLPRVMVEAFLREHVGVDAVVGPELRSVAGVVAGIMDDADAARVAARRLRALLGDEM
DQGEADGAGAAVGLVGEGRSGGTVHYLFSRYYCKETFTATEADKRRWRPLPPGGECGGVK
PLVFHDGRLAFPPTPSAALAMYAYLPFGVALAVSRIIALSLLPYGRATFLVGALTGVHYR
LVGAGHDAAAGGGGGRLYVCNHRTLLDPIVVAAALGKPVTAVTYSLSRVSEMIAPIRTAR
LTRDREEDRRSMAALLARGDLVVCPEGTTCREGYLLRFSPLFAELGADVNPVALDARVDM
FHGTSTTPAAKWMDPFYFMMNPKPSYRVEFLPRAAPAPAAEDGGDSIRVANRVQRQIGEA
LGFELTGMTRKDKYMMLAGNEGVVAAAAAAAATIKASR
NT seq 1557 nt   +upstreamnt  +downstreamnt
tcgtcgtcgccgctcgagctcgacaggctgtacggacggacggtggtggtggacgtggac
gcgtggctgctgctgccggccgtggacgcgttcaccttcttcatggtcgtcgccgtcgag
gccggcgggttcctccgcggcctcctgcttctgctcgtctacccgcttctgtgcctcctc
ctcggcgacggcgatggcggcggcggcgcgagggcgagggccatggcgacggtggcgctg
gtggggctggaggagagggaggtggccagggtgggccgggcggtgatgccgaggttcctc
atggcggcggcggcggcggagggcgcggaggcggtgagggcggcgcggcggtcggtcgcc
gtgagcgcgacgctcccgcgggtgatggtggaggcgttcctgcgggagcacgtcggcgtg
gacgccgtcgtggggccagagctgaggtcggtcgccggcgtcgtcgccgggatcatggat
gacgccgacgcggcccgggtggcggcgaggaggctccgggcgctgctcggcgacgagatg
gatcagggcgaggccgacggtgccggcgccgccgtggggctcgtcggagaggggaggagt
ggtggcacggtgcactacctcttctcgcgttactactgcaaggaaaccttcactgcgact
gaggctgacaagcggcggtggcggccgctgccgccgggcggcgagtgcggcggcgtcaag
ccgctcgtcttccacgacggccgcctcgccttcccgccgacgccgtccgccgcgctcgcc
atgtacgcctacctccccttcggcgtcgcgctcgccgtgtcgcgcatcatcgcgctgtcc
ctcctcccctacggccgcgccacgttcctcgtcggcgcgctcaccggcgtgcactaccgc
ctcgtcggcgccggccacgacgccgccgccggcggcggcggggggaggctctacgtgtgc
aaccaccgcacgctgctcgacccgatcgtggtggcggcggcgctggggaagccggtgacc
gcggtgacgtacagcctgagccgggtgtcggagatgatcgcgccgatccggacggcgagg
ctgacgcgcgaccgggaggaggatcgccggagcatggcggcgctgctggcgcgcggcgac
ctggtggtgtgccccgaggggacgacgtgccgggagggttacctgctccggttcagcccg
ctgttcgccgagctcggcgccgacgtgaaccccgtcgcgctcgacgcccgcgtcgacatg
ttccacggcacgtcgacgacgccggcggccaagtggatggaccccttctacttcatgatg
aacccgaagccgtcgtaccgcgtcgagttcctgccccgcgcggcgccggcgccggcggcg
gaggacggcggcgacagcatccgcgtcgcgaaccgggtgcagcgacagatcggcgaggcg
ctcgggttcgagctcaccgggatgaccaggaaggacaagtacatgatgctcgccggcaac
gaaggcgtcgtggccgccgccgcggcggcggcggcgaccatcaaagccagtcgttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328061
Entry
4328061           CDS       T01015                                 
Name
(RefSeq) glycerol-3-phosphate 2-O-acyltransferase 6
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4328061
   00564 Glycerophospholipid metabolism
    4328061
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4328061
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4328061
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4328061
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4328061
SSDB
Motif
Pfam: HAD Acyltransferase
Other DBs
NCBI-GeneID: 4328061
NCBI-ProteinID: XP_015626270
UniProt: Q6Z7C0
LinkDB
Position
2:complement(775468..778565)
AA seq 506 aa
MAAAAAAGRRRFFPPVTAYDAAAGARRTVAADLDGTLLVSSSAFPYYFLVALEAGSYLRA
LALLLAAPWLLALYVGVSEAAAIALLVFITFAGLRVRDVEAVARAVLPRHYAAGVRADTW
AVFHGCAERRVVVTASPAVMVGEFVREFLGAEVAGTELETFASGKRFTGRIKAVLVGEKK
REVVERLFAGGDMPDVGLGDRESDHDFMAICKEAYMVPKNKRAPRAAADELLSRAIFHDG
RLVRRPEPASALFALAYLPVGFAVALLRVFLNLPVPARLVRHTYRLTGIRLAVRGAPPPP
PRPGTPGSLLVCNHRTALDPIIVSIALGRPVTCVTYSVSRLSTAISPIRAAALTRDRAAD
AARIAALLEEGDVVVCPEGTTCREPYLLRFSALFAELTARIVPVAVEARQGTYYGSTARG
WKFLDPYFFYMNPRPGYEVTFLPALRPEETCVAGGRSAVEVANHVQRVIAKELGFQCTTL
TRKDKYMKLAGNDGRVAAAADKPKAN
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggggaggaggaggttctttccgccggtgacggcgtacgac
gcggcggcgggcgcgaggcggacggtggcggcggacctcgacgggacgctgctggtgtcg
tcgtcggcgttcccgtactacttccttgtggctctcgaggccggcagctacctccgcgcg
ctggcgctgctgctcgccgcgccgtggctcctcgcgctctacgtcggcgtctccgaggcc
gccgccatcgccctgctcgtgttcatcacgttcgccgggctgcgcgtccgcgacgtcgag
gccgtggcgcgcgccgtgctgccgcgccactacgccgccggggtgcgcgccgacacgtgg
gcggtgttccacggctgcgccgagcgccgcgtcgtggtcaccgcgtcgccggccgtcatg
gtgggggagttcgtgcgcgagttcctcggcgccgaggtggccggcaccgagctcgagacg
ttcgcctccggcaagcggttcaccggccgcatcaaggccgtcctcgtcggcgagaagaag
cgcgaggtcgtcgagaggctcttcgccggcggcgacatgcccgacgtcggcctcggcgac
cgcgagagcgaccacgacttcatggccatctgcaaggaagcctacatggtgcccaagaac
aagcgcgcgccgcgcgccgccgccgacgagctgctgtcgcgcgccatcttccacgacggc
cgcctcgtccgccgcccggagccagcgagcgcgctgttcgcgctggcctacctccccgtg
ggcttcgccgtggcgctcctccgcgtgttcctcaacctccccgtcccggcgcgcctcgtc
cgccacacctaccgcctcaccggcatccgcctcgccgtgcgcggggcgccgccgccgccg
ccgcgcccggggacgccgggctccctcctggtgtgcaaccaccgcaccgcgctggacccc
atcatcgtgtccatcgcgctgggccgccccgtgacgtgcgtgacgtacagcgttagccgg
ctgtcgacggcgatctcgccgatccgcgcggcggcgctgacgcgggaccgcgcggcggac
gcggcgcgcatcgcggcgctgctggaggagggggacgtggtggtgtgcccggaggggacg
acgtgccgggagccgtacctgctgcggttctcggcgctgttcgcggagctgacggcgagg
atcgtgccggtggcggtggaggcgaggcaggggacgtactatgggtcgacggcgaggggg
tggaagttcctggacccttacttcttctacatgaacccgcggccggggtacgaggtgacg
ttcctgccggcgctgaggccggaggagacgtgcgtcgccggcgggaggagcgcggtggag
gtggcgaaccacgtgcagagggtgatcgccaaggagctagggttccaatgcaccacgctc
accaggaaggacaagtacatgaagctcgccggcaacgacggccgggtcgccgccgccgcc
gacaagcccaaggccaattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334681
Entry
4334681           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate acyltransferase 3
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4334681
   00564 Glycerophospholipid metabolism
    4334681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4334681
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4334681
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4334681
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4334681
SSDB
Motif
Pfam: Acyltransferase HAD
Other DBs
NCBI-GeneID: 4334681
NCBI-ProteinID: XP_015629421
UniProt: A0A0N7KIC3 Q7Y144
LinkDB
Position
3:34985179..34990714
AA seq 541 aa
MSWKAFTKSLLFHSNKIVRRLKSFVLHAHPPPPPPHVVRRPPSSDELPAAADVTVCKVEG
GLLMSPSTFPYFMLVALEAGGLFRGLLLLLLYPVLLLLGHDRATKLMVMVSFAGVRKEKD
GSPSFRVGRAVMPKLFLEDVSAEVFDAAARRRRLVCVSSMPREMVEPFLKEYLAVDAVVA
PELRAFRGYYLGLAESDGEVMQRLDMEEVIGMKERGGAGDGDGDGQVTVVGIAGLGNSFH
QLFQNYCKEVYVASEWARRRWRPLHPRRYAKPLIFHDGRVAFRPTTSATLAMFVWLPLAV
PLALLRVALIVVVLPFSLAAPIAAALGIHCRCIAASTLRAAAVLDLFVCNHRSLLDPLYV
SAVAGRADLAAATYSISRLSEILAPIRTFRLTRDRAADRAAMQAHLSRSRRGGGGGGLVV
CPEGTTCREPFLLRFSPLFTELGADVQPVALHSEVAMFHGTTAGGWKMLDPFFLLMNPSP
AYVVHFLDPVAGGGGGPEVANEVQRRIAETLGYTCTALTRRDKYLVLAGNDGVVANNNKS
N
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtcgtggaaggccttcaccaagtccctcctcttccactccaacaagatcgtcaggcgg
ctcaaatccttcgtcctccatgcgcatcctcctccgccgccgccgcacgtcgtcaggcgg
ccgccgtcgtcggacgagctgccggcggcggcggacgtgacggtgtgcaaggtggagggc
ggcctgctgatgtcgccgtcgaccttcccgtacttcatgctcgtcgcgctggaggccggg
gggctcttccgcggcctcctcctgctgctgctctaccccgtgctgctcctgctcggccat
gaccgggccaccaagctcatggtcatggtcagcttcgccggagtcaggaaggagaaggac
gggtcgccgtccttccgggtgggcagggcggtgatgcccaagctgttcctggaggacgtc
agcgccgaggtgttcgatgcggcggcgcggcggcggcggctggtgtgcgtgagctccatg
ccgagggagatggtggagccgttcttgaaggagtacctcgccgtcgacgccgtcgtggcg
ccggagctgagggcgttcagggggtattaccttggcctcgcggagtccgacggcgaggtc
atgcagaggctggacatggaggaggtgatcgggatgaaggagcgcggcggcgccggcgac
ggtgacggtgatggacaggtcaccgtcgtcggcatcgccggactcgggaactcgttccat
cagctcttccaaaactattgcaaggaggtgtacgtggcgtcggagtgggcgcggcggcga
tggcgtcccctccatccccggcgatacgcgaagcccctcatcttccacgacggccgcgtc
gcgttccggccgacgacgtcggcgacgctggccatgttcgtgtggctgccgctggccgtg
cccctcgccctcctccgcgtcgccctcatcgtcgtcgtcctccccttctccctcgccgcc
ccgatcgccgccgccctcggcatccactgccgctgcatcgccgcctccacgctgcgggcc
gccgcggtcttggacctcttcgtctgcaaccaccgctccctcctcgacccgctctatgtc
tccgccgtcgccggccgcgccgacctcgccgccgccacctacagcatcagccgcctctcc
gagatcctcgccccgatccgcaccttccgcctcacccgcgaccgcgccgccgaccgcgcc
gccatgcaggcccacctctcccgctcccggcgcggcggcggcggcggcggcctggtggtg
tgcccggaggggaccacctgccgcgagccgttcctgctgcgcttcagcccgctcttcacg
gagctcggcgccgacgtgcagcccgtggcgctgcactcggaggtggccatgttccatggc
accacggccggggggtggaagatgctcgaccccttcttcctcctcatgaacccctcgccg
gcctacgtcgtgcacttcctcgaccccgtcgccggcggcggcggcggcccggaggtggcc
aacgaggtgcagcgccggatcgcggagacgctggggtacacctgcacggcgctcacgcgg
agggacaagtacctcgtgctcgccggcaacgatggcgtcgtcgccaacaacaacaagagc
aattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338289
Entry
4338289           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate acyltransferase 3
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4338289
   00564 Glycerophospholipid metabolism
    4338289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4338289
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4338289
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4338289
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4338289
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 4338289
NCBI-ProteinID: XP_015638232
UniProt: A0A0P0WKE6 Q75IG9
LinkDB
Position
5:complement(11753279..11756397)
AA seq 537 aa
MAKKPCEFPTAVLSFRRFLQRRFLGGRHHHRPTSTTATGAAIPPADKLHNQTVMIDLESW
LLRSPMSTFPYFMIVAIEAGSFLRGLILLLIYPLLWLLLSHDMLLKAMVMVSFFGLPEKE
VVRIGKAVLPKFFLEGMAMEGLEVVRNAKKVVVFSPLFPRVMVEGFLKEYIGVNAVIGRE
VIAVAGRYVGLLVDHIDMDDGGFVDEVMEETKRGKGDGAVGLAGVGSKMHHLFSRYCKET
YVVCDADKKEWQPVPREKYPKPLIFHDGRLAFKLTPCAAVAMYTYLPWGIFLAVFRSLAF
GLLPYRVSVPLAAFTGMRSRLIAGPSPDATRRNSGTAGGRLYVCNHRTLLDPITVAAVLN
KPITAVTYSVSPVSELIAPIRTARLTRDRDEDRRRMEALLARGDLVVCPEGTTCREPYLL
RFSPLFAELTGEVTPVALETRIDMFYGTSTKPAAKWLDPFYFMLNSRPEYHVEFLQPVST
APVDGEAGGHGHSINAANRVQRVLGEALAFELTEQTRKDKYEMLAGNKGNVKGEAKM
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcgaagaagccatgtgaatttccaacggccgttctctccttccgtcgcttcctccag
agacgcttcttgggagggcggcaccaccaccgcccaacgtcgaccacggcaactggtgca
gctataccaccggcagataagctacacaaccaaactgtaatgattgatctggagtcatgg
ctactgaggtcgcccatgtcgaccttcccttacttcatgatcgtcgccatcgaggccggt
agcttcctccgcggcctcatcctgctgctgatataccctctcttatggctccttctcagc
catgacatgcttctcaaggccatggtcatggtgtccttctttgggttgcccgagaaggag
gtggtcaggattggtaaggcagttctaccaaagttcttcctggaagggatggccatggag
gggctggaggtggtgaggaacgcgaagaaagtggtcgtgtttagtccgttgtttccgagg
gtgatggtcgagggtttcttgaaagagtacataggcgtgaacgctgtcatcggaagggag
gtcatagcggttgccgggcgttacgtcgggctcctcgtcgaccacattgacatggacgat
ggaggttttgttgacgaggtgatggaagagacgaagcgcggcaagggcgacggagctgtt
gggcttgctggagtgggcagcaagatgcatcatctgttttctcgttattgcaaggaaacc
tatgttgtatgtgacgccgacaagaaggaatggcagccggtgccaagagagaagtaccct
aaacctttgatcttccacgatggccggctcgccttcaagctgacgccctgtgccgcggtg
gcgatgtacacctacctaccttggggtatcttcctcgccgtcttccgcagcctggcattt
ggcctcctcccctaccgtgtgtccgtccctctcgccgcgttcactggcatgcgctcccgt
ctgatcgccggcccgtcgcctgatgccacccgccggaacagcgggacggccgggggtcgc
ctctacgtctgcaaccaccgcacgctcctggaccctattaccgtcgcggccgtgctgaac
aagcccatcactgcggtgacgtacagtgtaagcccggtatcggagttgattgcgccaatc
cgcacggcgcgcctgacgcgcgaccgggacgaggaccggcggcgcatggaggcgctgctg
gcgcgcggcgacctcgtggtgtgccccgagggcaccacgtgccgtgagccgtacctcctt
cggtttagcccactcttcgctgagctcaccggcgaggtgacccccgttgcgctggagaca
cggattgacatgttctacggcacgtcgacgaagcctgccgccaagtggctggacccattc
tacttcatgctgaattcgagaccggagtaccacgtcgagttcctgcagcccgtcagcacc
gctccagtagacggtgaggcaggcggtcacggccacagtatcaacgccgcaaacagggta
cagcgcgtgctcggcgaggcgcttgcattcgagctgacagagcagacgcgaaaggacaag
tacgagatgctggccgggaataaagggaacgtgaaaggtgaagccaagatgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338951
Entry
4338951           CDS       T01015                                 
Name
(RefSeq) glycerol-3-phosphate 2-O-acyltransferase 6
  KO
K13508  glycerol-3-phosphate acyltransferase [EC:2.3.1.15 2.3.1.198]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4338951
   00564 Glycerophospholipid metabolism
    4338951
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4338951
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     4338951
    2.3.1.198  glycerol-3-phosphate 2-O-acyltransferase
     4338951
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  GPAT
   4338951
SSDB
Motif
Pfam: HAD Acyltransferase
Other DBs
NCBI-GeneID: 4338951
NCBI-ProteinID: XP_015638952
UniProt: B7F8I5 A0A8J8Y5V9
LinkDB
Position
5:22005151..22008924
AA seq 486 aa
MSPFKPIEQCSTEGRSQQTVASDLDGTLLLSRSAFPYYLLVALEAGGPLRAVALLMSVPF
VYLTYVTISESLAVRALLYIAVAGLEVRDVESVARSVLPRFYAGDVHPEGWRVFSSFGRR
CVVTASPRVMVEPFARAFLGADRVIGTELEVGEDGRATGFVAKPGVLIREHKRNAVVREF
GDALPDVGMGDRESDFDFMAICKDAYVVTTSRKHRPVPESQLLRTVVLHDGRLAQRPTAI
NTLLVFLWMPVGFALALLRACLSLLLPERVLSYAYKLTGVGLVVRGRPPPPDGSPGVLFV
CNHRTVLDQVAVAAALGRKVICVTYSVPRKTYGMSSRLPEALTASPVKAAVALCRERDRD
ADRVRRLLEEGVDIVAFPEGTTCRGAFLLRFSSLFAELTDRIVPVAIATRETMFHGSTAR
GFKGMDPYFFFMNPRPAYEVTFLSQLPSELTSGGGGKSPVEVANYVQKALAGQLGSEHIG
ITRKEK
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcgccgttcaagccgatcgagcagtgctcgacggaggggcggtcgcagcagacggtg
gcctccgacctcgacggcacgctgctcctgtcccgcagcgccttcccgtactacctcctc
gtcgcgctcgaggccggcggccccctccgcgcggtcgcgctgctcatgtccgtgcccttc
gtctacctcacgtacgtcaccatctccgagtccctcgccgtgcgcgcgctgctgtacatc
gccgtggcgggtctcgaggtgagggacgtcgagtcggtggcgcggtcggtgctgcccagg
ttctacgccggcgacgtccacccggaggggtggcgggtgttcagctcgttcggcaggagg
tgcgtcgtgacggcgagccccagggtgatggtggagccgttcgcgagggcgttcctcggc
gcggacagggtcatcggcacggagctggaggtcggcgaggacggcagggccaccggcttc
gtcgccaagcccggcgtgctcatccgcgagcacaagaggaacgcggtggtgagggagttc
ggcgacgcgctgccggacgtcggcatgggggacagggagagcgacttcgacttcatggcc
atctgcaaggacgcgtacgtcgtgaccacctcgcggaagcaccggccggtgccggagagc
cagctgctgagaaccgtcgtcctccacgacggccgcctcgcccagcgcccgacggcgatc
aacacgctgctcgtcttcctctggatgccggtcggcttcgcgctcgcgctcctccgcgcg
tgcctcagcctgctcctccccgagcgcgtcctctcctacgcctacaagctcacgggcgtc
gggctcgtggtgcgcggccgcccgccgccgccggacgggagccccggcgtgctcttcgtg
tgcaaccaccgcaccgtgctcgaccaggtcgccgtcgccgccgcgctgggccgcaaggtg
atctgcgtcacgtacagcgtccctcggaaaacgtacggcatgagctccaggctcccggag
gcgctcacggcctcgccggtcaaggccgccgtcgcgctgtgcagggagcgcgacagggac
gcggaccgtgtccggcggctgctggaggagggcgtcgacatcgtcgccttccccgagggc
accacctgccgaggggcgttcctgctgcggttcagctcgctgttcgccgagctcaccgac
cgcatcgtgccggtggccatcgccaccagggagaccatgttccacggctccacggcgcgc
gggtttaagggcatggacccttacttcttcttcatgaacccgcggccggcgtacgaggtc
acgttcctgagccagctgccgagtgagctcacctccggcggcggcggcaagtcgccggtc
gaggtggccaactacgtgcagaaggcgctcgccgggcagctggggtccgagcacatcggc
atcacgcgcaaggagaagtag

DBGET integrated database retrieval system