KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275966
Entry
107275966         CDS       T01015                                 
Name
(RefSeq) U4/U6 small nuclear ribonucleoprotein PRP4-like protein
  KO
K12662  U4/U6 small nuclear ribonucleoprotein PRP4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107275966
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    107275966
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    107275966
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40 PRP4 WD40_like LCE
Other DBs
NCBI-GeneID: 107275966
NCBI-ProteinID: XP_015630887
UniProt: Q10LA2
LinkDB
Position
3:13570876..13574867
AA seq 524 aa
MENPRPQAPAGTPPMAPLPVPPPIAPIPAPPPRAPAPAPAAAAAVASTSAAGGGGGGGGE
ADYEVSDDHRAARERHERAVQELLQRRRAFAMAVPTNDSAVRARLRRLGEPVTLFGEREM
ERRDRLRALMVRLEADGHLDRLLRAQEEEQGAAGAEEEEEQIQYPFFTEGTQELLKARVD
IAQYSLPRAKARIERAKRCHDDPDEDPEAEANLVVKQAEDFVLECSEIGDDRPLTGCSFS
RDFSMLATSSWSGMIKVWSMPQVTKIATLKGHTERATDVAFSPVDDCLATASADKTAKLW
KTDGSLLLSFDGHLDRLARLAFHPSGGYLATASFDKTWRLWDVSTGKELLLQEGHSRSVY
GVSFHPDGSLAASCGLDAYARVWDLRSGRLWGTLMGHVKPVLGVSFSPNGYLVATGSEDN
FCRIWDLRTKRMLYSIPAHKSLISHVKFEPQEGYYLATSSYDTKAALWSARDYKPIKSLV
AHESKVTSLDISGDGQQIVTVSHDRTIKIWSCRSRAQDNAMELD
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggagaaccccaggccacaggctcctgcggggacccctcccatggctcccctccccgtg
cccccgcccatcgcccccatccctgccccgcctccgcgagccccagcacccgccccggcc
gccgccgccgccgtcgcctcgacctccgcggcgggaggaggcggcgggggcggcggtgag
gctgactacgaggtctccgatgaccaccgcgccgcgcgggagcgccacgagcgcgcggtg
caggagctgctccagcgccgccgcgccttcgccatggccgtgcccaccaacgactccgcc
gtgcgggcgcgcctccgccgcctcggcgagcccgtcacgctcttcggcgagcgcgagatg
gagcgccgggaccgcctccgcgctctcatggtccgcctcgaggccgacggccacctcgac
cgcctcctccgcgcgcaggaggaggagcagggcgccgcgggcgccgaagaggaggaggag
cagatccagtaccccttcttcaccgagggcacgcaggagcttctcaaggcgcgcgtcgac
atcgcgcagtactcgctgccccgagccaaggccaggatagagcgggccaagcgctgccat
gacgaccccgacgaggaccctgaggcagaggccaaccttgtcgttaagcaggcggaggat
ttcgtgcttgagtgcagcgagattggagatgaccgccccctcaccggctgctccttctct
cgagatttttcaatgctcgctacaagttcatggagtgggatgatcaaagtgtggagtatg
ccacaagtaactaaaattgcaactctgaaaggtcacacagaacgtgcaactgatgttgcg
ttttcaccagttgacgactgcttagcaacagcttcagctgataaaactgccaaactatgg
aagaccgatgggtcactcttattgtcctttgatggtcacctcgatcggcttgctcgcctt
gcttttcatccatctggagggtaccttgctacagctagctttgacaaaacctggagattg
tgggacgttagcactggaaaggaacttctactccaagaagggcacagcagaagtgtctat
ggagttagctttcacccagatggttctttagctgcatcttgtggtcttgatgcgtatgct
cgagtttgggatttaagatcaggaagattgtggggcacactcatgggacatgtgaagcct
gtcttaggagtgagcttctcccctaatggttatctggttgcaactggaagtgaagacaat
ttctgtcgaatatgggatttgaggactaaaagaatgttatattctataccagcacataag
agtcttatctcacatgtcaagtttgaaccccaggaaggctattatttggcaacttcgtcc
tatgacaccaaagcagcactgtggtcagctcgtgattacaaaccaatcaagagtttggtg
gcccatgagtcaaaggttactagtttggatattagtggagatggacagcagattgtgact
gtgtcacatgatagaacgatcaagatttggtcctgcagaagcagggcacaagataatgcc
atggagctggactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332861
Entry
4332861           CDS       T01015                                 
Name
(RefSeq) U4/U6 small nuclear ribonucleoprotein PRP4-like protein
  KO
K12662  U4/U6 small nuclear ribonucleoprotein PRP4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332861
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332861
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4332861
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40 PRP4 WD40_like LCE
Other DBs
NCBI-GeneID: 4332861
NCBI-ProteinID: XP_015633281
UniProt: Q10LA2
LinkDB
Position
3:13580506..13584496
AA seq 524 aa
MENPRPQAPAGTPPMAPLPVPPPIAPIPAPPPRAPAPAPAAAAAVASTSAAGGGGGGGGE
ADYEVSDDHRAARERHERAVQELLQRRRAFAMAVPTNDSAVRARLRRLGEPVTLFGEREM
ERRDRLRALMVRLEADGHLDRLLRAQEEEQGAAGAEEEEEQIQYPFFTEGTQELLKARVD
IAQYSLPRAKARIERAKRCHDDPDEDPEAEANLVVKQAEDFVLECSEIGDDRPLTGCSFS
RDFSMLATSSWSGMIKVWSMPQVTKIATLKGHTERATDVAFSPVDDCLATASADKTAKLW
KTDGSLLLSFDGHLDRLARLAFHPSGGYLATASFDKTWRLWDVSTGKELLLQEGHSRSVY
GVSFHPDGSLAASCGLDAYARVWDLRSGRLWGTLMGHVKPVLGVSFSPNGYLVATGSEDN
FCRIWDLRTKRMLYSIPAHKSLISHVKFEPQEGYYLATSSYDTKAALWSARDYKPIKSLV
AHESKVTSLDISGDGQQIVTVSHDRTIKIWSCRSRAQDNAMELD
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggagaaccccaggccacaggctcctgcggggacccctcccatggctcccctccccgtg
cccccgcccatcgcccccatccctgccccgcctccgcgagccccagcacccgccccggcc
gccgccgccgccgtcgcctcgacctccgcggcgggaggaggcggcgggggcggcggtgag
gctgactacgaggtctccgatgaccaccgcgccgcgcgggagcgccacgagcgcgcggtg
caggagctgctccagcgccgccgcgccttcgccatggccgtgcccaccaacgactccgcc
gtgcgggcgcgcctccgccgcctcggcgagcccgtcacgctcttcggcgagcgcgagatg
gagcgccgggaccgcctccgcgctctcatggtccgcctcgaggccgacggccacctcgac
cgcctcctccgcgcgcaggaggaggagcagggcgccgcgggcgccgaagaggaggaggag
cagatccagtaccccttcttcaccgagggcacgcaggagcttctcaaggcgcgcgtcgac
atcgcgcagtactcgctgccccgagccaaggccaggatagagcgggccaagcgctgccat
gacgaccccgacgaggaccctgaggcagaggccaaccttgtcgttaagcaggcggaggat
ttcgtgcttgagtgcagcgagattggagatgaccgccccctcaccggctgctccttctct
cgagatttttcaatgctcgctacaagttcatggagtgggatgatcaaagtgtggagtatg
ccacaagtaactaaaattgcaactctgaaaggtcacacagaacgtgcaactgatgttgcg
ttttcaccagttgacgactgcttagcaacagcttcagctgataaaactgccaaactatgg
aagaccgatgggtcactcttattgtcctttgatggtcacctcgatcggcttgctcgcctt
gcttttcatccatctggagggtaccttgctacagctagctttgacaaaacctggagattg
tgggacgttagcactggaaaggaacttctactccaagaagggcacagcagaagtgtctat
ggagttagctttcacccagatggttctttagctgcatcttgtggtcttgatgcgtatgct
cgagtttgggatttaagatcaggaagattgtggggcacactcatgggacatgtgaagcct
gtcttaggagtgagcttctcccctaatggttatctggttgcaactggaagtgaagacaat
ttctgtcgaatatgggatttgaggactaaaagaatgttatattctataccagcacataag
agtcttatctcacatgtcaagtttgaaccccaggaaggctattatttggcaacttcgtcc
tatgacaccaaagcagcactgtggtcagctcgtgattacaaaccaatcaagagtttggtg
gcccatgagtcaaaggttactagtttggatattagtggagatggacagcagattgtgact
gtgtcacatgatagaacgatcaagatttggtcctgcagaagcagggcacaagataatgcc
atggagctggactga

DBGET integrated database retrieval system