KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275990
Entry
107275990         CDS       T01015                                 
Name
(RefSeq) cytokinin hydroxylase-like
  KO
K10717  cytokinin trans-hydroxylase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    107275990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    107275990
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP735 family
   107275990
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107275990
NCBI-ProteinID: XP_015649532
LinkDB
Position
8:complement(20761048..20763943)
AA seq 536 aa
MAMAAAVLVAIALPVSLALLLVAKAVWVTVSCYYLTPARIRRVLASQGVRGPPPRPLVGN
LRDVSALVAESTAADMASLSHDIVARLLPHYVLWSNTYGRRFVYWYGSEPRVCVTEAGMV
RELLSSRHAHVTGKSWLQRQGAKHFIGRGLLMANGATWSHQRHVVAPAFMADRLKGRVGH
MVECTRQTVRALRDAVARSGNEVEIGAHMARLAGDVIARTEFDTSYETGKRIFLLIEELQ
RLTARSSRYLWVPGSQYFPSKYRREIKRLNGELERLLKESIDRSREIADEGRTPSASPCG
RGLLGMLLAEMEKKEAGGNGGGEVGYDAQMMIDECKTFFFAGHETSALLLTWAIMLLATH
PAWQDKARAEVAAVCGGGAPSPDSLPKLAVLQMVINETLRLYPPATLLPRMAFEDIELGG
GALRVPSGASVWIPVLAIHHDEGAWGRDAHEFRPDRFAPGRPRPPAGAFLPFAAGPRNCV
GQAYAMVEAKVALAMLLSSFRFAISDEYRHAPVNVLTLRPRHGVPVRLLPLPPPRP
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcaatggccgccgccgtcctcgtcgccatcgcattgccggtctcgctggcgctgctg
ctggtggccaaggccgtctgggtcaccgtctcatgctactacctcacgccggcgaggatc
cggcgggtcctggcgagccagggcgtgcgcggcccgccgccgcggccgctcgtcggcaac
ctccgcgacgtgtcggcgctcgtcgccgagtccaccgccgccgacatggcctccctcagc
cacgacatcgtcgcccgcctcctcccccactacgtcctctggtccaacacgtacgggagg
cggttcgtgtactggtacgggagcgagccgcgggtgtgcgtgacggaggccggcatggtg
cgggagctcctgtcgtcgcggcacgcgcacgtcaccggcaagtcgtggctgcagcggcag
ggcgccaagcacttcatcggccgtggcctcctcatggccaacggcgccacctggtcgcac
cagcgccacgtcgtcgcgccggcgttcatggccgaccggctcaaggggagggtggggcac
atggtggagtgcacgaggcagacggtgcgggcgctgagggatgcggtggcgaggtccggg
aacgaggtggagatcggcgcgcacatggcgaggctcgccggcgacgtgatcgcgcgcacc
gagttcgacacgagctacgagaccggcaagaggatcttcctcctcatcgaggagctccag
cgcctcaccgcccgctccagccgctacctctgggtccccggcagccagtattttccgagc
aagtacaggagagagataaagcggctgaacggcgagctggagcggctgctcaaggagtcc
atcgaccggagccgggagatcgccgacgagggccggacgccgtcggcgtcgccgtgcggc
cgtggcctcctcggcatgctgctggccgagatggagaagaaggaggccggcggcaatggc
ggcggcgaggtcgggtacgacgcccagatgatgatcgacgagtgcaagaccttcttcttc
gccggccacgagacgtcggcgctgctcctcacctgggccatcatgctgctcgccacgcac
ccggcgtggcaggacaaggcgcgcgccgaggtcgccgccgtctgcggcggcggcgcgccg
tcgccggacagcctcccgaagctcgccgtgctccagatggtgatcaacgagacgctgcgg
ctgtacccgccggcgacgctgctgccgcggatggcgttcgaggacatcgagctcggcggg
ggcgcgctccgggtgccgagtggcgcgtcggtgtggatcccggtgctcgccatccaccac
gacgagggcgcgtggggccgcgacgcgcacgagttcaggccggacaggttcgcgccggga
cggccgcggccgccggcgggggcgttcctgccgttcgccgccgggccgcgcaactgcgtc
gggcaggcgtacgccatggtggaggccaaggtcgcgctcgccatgctcctctccagcttc
cgcttcgccatctccgacgagtaccggcacgcgccggtgaacgtgctcacgctccggcca
cgccacggcgtgcccgtccgcctcctgccgctgccgccgccgcgcccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269428
Entry
9269428           CDS       T01015                                 
Name
(RefSeq) cytokinin hydroxylase
  KO
K10717  cytokinin trans-hydroxylase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00908  Zeatin biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    9269428
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    9269428
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP735 family
   9269428
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9269428
NCBI-ProteinID: XP_015610762
LinkDB
Position
9:complement(14194157..14196845)
AA seq 533 aa
MAVLVSLMVIAASSPLVALLLRAAWVTLSCYWLTPMRIRRAMAAQGVRGPPPRPLVGNLR
EVSALVARATADDMPSLSHDIVGRLMPHYVLWSGTYGKLFVYLYGSEPRLCLTDTALIKE
FLSSKYAHATGKSWLQRQGTKHFIGGGLLMANGARWAHQRHVVAPAFMADKLKGRVGRMV
ECTKQAIRELRDAAAGRRGEEVEIGAHMTRLTGDIISRTEFNTSYDTGKRIFLLLEHLQR
LTSRSSRHLWIPGSQYFPSKYRREIRRLNGELEAVLMESIRRSREIADEGRAAVATYGRG
LLAMLLSEMEEKEKNGGGGGGEFSYDAQLVIDECKTFFFAGHETSALLLTWAIMLLATNP
AWQEKARTEVAAVCGDHPPSADHLSKLTVLQMIIQETLRLYPPATLLPRMAFEDIQLGGL
RLPRGLSVWIPVLAIHHDESIWGPDAHEFRPERFAPGARRPSAAGAARFLPFAAGPRNCV
GQAYALVEAKVVLAMLLSAFRFAISDNYRHAPENVLTLRPKHGVPVHLRPLRP
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcggtcctcgtgtcgctcatggtgatcgccgcgtcgtcgcctctcgtggcgctgctt
ctgagggcggcgtgggtgaccctgtcctgctactggctgacgccaatgaggatccgccgc
gccatggcggcgcagggcgtgcgcggcccgccgccgcgcccgctcgtcggcaacctccgg
gaggtgtcggcgctcgtggcgagggccaccgccgacgacatgccgtccctcagccacgac
atcgtcggccgcctcatgccccactacgtgctctggtccgggacatacggcaagctgttc
gtgtacctgtacgggagcgagccgaggctgtgcctgactgacaccgcgctgatcaaggag
ttcttgtcgtccaagtacgcccacgccaccggcaagtcgtggctgcagaggcaggggacg
aagcacttcatcggcggcgggctgctcatggccaacggcgccaggtgggcgcaccagcgc
cacgtcgtcgcgccggcgttcatggccgacaagctcaaggggagagtcgggcgcatggtg
gagtgcacgaagcaggcgatccgcgagctccgcgacgcggcggcggggcggcgcggcgag
gaggtggagatcggcgcccacatgacccgcctcaccggcgacatcatctcccgcaccgag
ttcaacaccagctacgacactggcaagcgcatcttcctcctcctcgagcacctccagcgc
ctcacctcccgctccagccgccatctctggatccccggcagccagtatttcccgagcaag
tacaggagggagatcaggcggctcaacggcgagctggaggcggtgctgatggagtcgata
cggcggagcagggagatcgccgacgaggggagggcggcggtggcgacgtacgggaggggt
ttgctggctatgcttctgtcggagatggaggagaaggagaagaatggcggcggcggaggc
ggcgagttcagctacgacgcgcagctggtgatcgacgagtgcaagaccttcttcttcgcc
ggccacgagacgtcggcgctgctgctcacgtgggcgatcatgctgctcgccaccaacccg
gcgtggcaggagaaggcccgcaccgaggtcgccgccgtctgcggcgaccacccgccgtcc
gccgaccacctctccaagctcaccgtgctgcagatgatcatccaggagacgctgcggctg
tacccgccggcgacgctgctgccgcggatggcgttcgaggacatccagctcggcggcctc
cggctgccgcgggggctgtcggtgtggatcccggtgctggccatccaccacgacgagtcc
atctggggccccgacgcgcacgagttccgcccggagaggttcgcgccgggcgcgcgccgc
ccgtcggccgccggcgccgccaggttcctgccgttcgccgccggcccgcgcaactgcgtc
ggccaggcgtacgcgctcgtcgaggccaaggtcgtcctcgccatgctcctctcggccttc
cgcttcgccatctccgacaactaccgccacgcgccggagaacgtgctcaccctccgcccc
aagcacggcgtccccgtccacctccggccgctgcggccatag

DBGET integrated database retrieval system