KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276010
Entry
107276010         CDS       T01015                                 
Name
(RefSeq) BRCA1-associated RING domain protein 1-like
  KO
K10683  BRCA1-associated RING domain protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107276010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    107276010
   04121 Ubiquitin system [BR:osa04121]
    107276010
   03036 Chromosome and associated proteins [BR:osa03036]
    107276010
   03400 DNA repair and recombination proteins [BR:osa03400]
    107276010
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     107276010
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    107276010
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107276010
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     107276010
SSDB
Motif
Pfam: BRCT zf-HC5HC2H BRCT_2 PTCB-BRCT zf-HC5HC2H_2 zf-ANAPC11
Other DBs
NCBI-GeneID: 107276010
NCBI-ProteinID: XP_015638145
LinkDB
Position
5:complement(23931397..23937038)
AA seq 503 aa
MPGKHGNDGMSKDMGRATRLKRLQTPINLFEDECVFCHSFRTPPQFHGPMAHYQKGKLVS
SDNGSPCPTDIIYVHKKCLEWAPQVFYEGDTIVNLELEIKRAAKLKCKRCKLPGAALGCY
YTKCNRSYHVPCAMMTLNCRWDVDNGCVMCPEHATMPLPCDKISSPRNESGNSSSFPQSQ
SSIEQSDSADCEWEYPIIDQWNTSSSLSQGQSSAKEGISAVPKREIDQLNTSCSSFPEGQ
YLDKEGISTDEYRKEKQTDHLYTERDCPSDLWVLLGSALSESEKDSLQEFASWTDATVVN
EWTENVTHVIVGKSAGSAWSRSYEVLMALLFGKWVVTVGWIMDCLVKFIPSPEASFELRF
SHDSRASIGGNKKRRNQASEGAQKLFSGLNFCLSAYINPDDRQHIQSLIAAAGGQILETN
GGSHLLRENLEKVAVKPCYFVYDGGAPRDFTQGLLDDLPKEMEEGREYAACGAQVISHLR
VFDAIAAYDAQILSHKDHFTPDV
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgcctggaaaacatggcaacgatggcatgtcaaaagacatgggacgtgctactagattg
aagagactgcaaacgccaatcaacttatttgaagatgaatgcgttttctgccattcattt
agaacacctcctcagtttcatggtccaatggcgcattatcaaaagggaaagcttgtgtcc
agtgacaatggcagtccatgcccaacagatatcatttatgttcataagaaatgcctggag
tgggccccgcaagtattttacgaaggtgataccattgtgaacttggagttggaaataaaa
cgtgccgcgaaattgaagtgcaaaagatgcaagcttcctggagcagctcttgggtgttat
tatacaaagtgcaataggagctatcatgttccatgtgcaatgatgactttgaattgccgc
tgggatgttgataacggttgtgttatgtgccctgaacatgcaacgatgccactaccatgt
gataagataagctcgccaagaaatgagagtggcaattcttcttccttccctcagagccaa
tcgtcaattgaacaaagcgattccgctgattgcgaatgggaatatcctataatagatcaa
tggaacacatcaagttctttgtctcaaggacaaagttcagccaaagaaggaatttctgct
gttcctaaaagggaaatagatcaacttaacacttcatgttcttcctttcctgagggccaa
tacttggacaaagaaggaatttccactgacgaatacaggaaagaaaagcaaacagatcac
ctttacacagaaagagattgcccctcggatctgtgggttttgcttggttcagctttaagt
gaatccgagaaggattccttgcaagagtttgcgtcttggacagatgcaactgtggtcaac
gagtggactgaaaatgtgacccatgttatcgttggaaaaagtgctggtagtgcatggagc
cgatcttatgaggtcctgatggctctactgtttgggaaatgggttgtcacggttggatgg
attatggattgcttggtaaagtttattccaagtccagaagcttcctttgagttaagattt
agccatgactcacgtgcatcaattggtggaaacaagaaaagaagaaatcaagcttctgaa
ggggcacagaagttgttctcgggactgaacttttgcctcagtgcctacataaaccctgac
gacagacaacacatacagagcctgattgcagctgctggagggcagatactggagacaaac
ggcggctcgcatttgctgcgtgaaaacctggagaaagttgctgtgaagccatgctacttc
gtctacgacgggggcgctccaagggatttcacccaaggattgcttgatgatctccctaag
gagatggaagagggcagagagtatgctgcctgtggagctcaggtgatcagccatttgagg
gtgtttgatgccattgcggcttatgatgcacagattctcagccacaaggatcacttcacc
ccggatgtgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336384
Entry
4336384           CDS       T01015                                 
Name
(RefSeq) BRCA1-associated RING domain protein 1 isoform X1
  KO
K10683  BRCA1-associated RING domain protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4336384
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4336384
   04121 Ubiquitin system [BR:osa04121]
    4336384
   03036 Chromosome and associated proteins [BR:osa03036]
    4336384
   03400 DNA repair and recombination proteins [BR:osa03400]
    4336384
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     4336384
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    4336384
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     4336384
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     4336384
SSDB
Motif
Pfam: BRCT zf-HC5HC2H BRCT_2 zf-RING_UBOX zf-HC5HC2H_2 zf-C3HC4_3 PTCB-BRCT zf-C3HC4 zf-C3HC4_4 RTT107_BRCT_5 zf-C3HC4_2 zf-RING_5 zf-RING_10
Other DBs
NCBI-GeneID: 4336384
NCBI-ProteinID: XP_015634058
UniProt: B9FG45 Q7XPZ2
LinkDB
Position
4:complement(25611669..25615819)
AA seq 629 aa
MESFRRFLNPLVLNLQKMELELTCPVCLKLLNAPTMLPCYHTSCSKCATTRTMDGYSCAI
CKSAYRSQDLRPASHLEAIVNIHRSLSSTVSSMVTQQEAQADIPVAKTSFQGTPESGNRN
GAEKSDQVKSYTPVASKLAYNQSTGLAYGNVDGVKERNPALETRGAADVTAMPTILVQKG
PCRSQSSDGPRDLDCDSNDLEGELITSRSSPQSVLKREPNTANDDNRELKRQKSTDQDDR
QPAVAGAWKCEFCHSSKTTESTGPLSHYLHGEPLEDNQAWKPNVLHVHEKCIEWAPQAFF
TGDIANNLEPELARASKIKCSVCGLKGAALGCLVKSCRKSFHVPCAHGISGCRWDDENFV
MLCPSHSSKKLPCERSKSKNKKTSLQRSSSDTMLDDLNSPSTIHMDGLWTASPFLTSEWV
ICGSALSSQEKEILDQFEHQTGITVTNGWRSNVTHVIANTDECGACARTLKVLMAILAGK
WVLNINWLKACMEAKEPVPEEPYEISSDVHGSFDGPRMGRLRAMQNAPHLFAGLTFYFSG
HFMPNYKVHLEDLITAAGGSILDKADLSSTSLIIYSMEPPQGSDPDTLNEVIRKRKAEAE
ELAATIGSRAVPHTCVLDSIASCTVQLTM
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggagagcttcaggaggttcctgaacccgctggtgctcaacctgcagaagatggagctg
gagctcacctgccccgtctgcctgaagttgctcaacgcgcctaccatgctgccatgttac
cacacttcctgcagcaagtgtgctactacacggaccatggacggttacagctgcgcgatt
tgcaaatcagcttatcgttctcaagacctaaggcctgcctctcacctcgaggcaatagtg
aacatccacaggagcctaagctctacagtcagcagcatggtcactcagcaggaggctcaa
gctgatattcctgttgcaaagacatcatttcaaggaactccagaatcgggaaacagaaat
ggagcagagaaatctgatcaggtgaaatcatacaccccggttgcttctaaactggcatat
aaccagtcaactgggcttgcatatggaaatgtggacggcgtgaaagaaagaaatcctgca
ttggagactagaggtgcggctgatgtgactgctatgcccacaattcttgtgcagaaggga
ccctgccgatctcaatcttctgatggccctagggatctggattgcgacagcaatgacctt
gaaggagagctgataacaagcagatcatctcctcaaagtgtcttgaaaagagaaccaaat
acagcgaatgatgataatagagaattaaaaaggcaaaagtccactgatcaggatgataga
caaccagctgttgctggtgcttggaaatgtgaattttgtcactcttccaaaaccactgag
agtactggccctctgtcccattatctgcatggtgagccattagaggataaccaagcatgg
aaaccaaacgttttacatgttcatgagaagtgcattgaatgggcccctcaagcgttcttt
actggtgacattgcaaataacttggagcctgagttggcccgtgcttctaagatcaaatgc
agtgtttgtggactaaaaggtgcagcccttggctgccttgtcaagagctgccgcaagagc
tttcatgttccatgtgcccatgggatatcaggctgccgatgggatgatgagaactttgtt
atgctgtgtccttctcattcctcgaagaagttgccatgtgagagatcaaagtcaaaaaat
aagaagaccagcttgcagcgatcatcttccgatacaatgcttgatgacctgaactcacca
tctacaatccatatggatggactttggactgcttcaccttttctcactagtgaatgggtt
atatgtggatctgctctctctagtcaggagaaggaaatcttggaccagtttgagcaccaa
actggcatcactgtaactaacggttggaggtcgaatgtgactcatgtgattgctaatacg
gatgaatgtggggcatgtgccaggacactcaaggttctcatggccatactagctgggaaa
tgggttctgaatataaactggctgaaagcttgtatggaggctaaagaaccagtcccagaa
gagccttatgagatcagttctgatgttcatggctcctttgatggccctcgcatgggaaga
ctacgagcaatgcaaaatgcaccacatctgtttgcaggattgaccttttacttcagtggc
catttcatgcccaattacaaggttcaccttgaagatttgatcactgcagctgggggatca
atcttggacaaggctgatctctctagcacatccttgataatttacagcatggagccacca
caaggaagtgatcctgatacccttaatgaggtcatcagaaagaggaaggctgaggctgaa
gaattggcggcaacgattggctccagggctgttcctcatacatgtgttctggattctatt
gcatcatgcacagtgcaattgaccatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339293
Entry
4339293           CDS       T01015                                 
Name
(RefSeq) protein BREAST CANCER SUSCEPTIBILITY 1 homolog isoform X1
  KO
K10683  BRCA1-associated RING domain protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4339293
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4339293
   04121 Ubiquitin system [BR:osa04121]
    4339293
   03036 Chromosome and associated proteins [BR:osa03036]
    4339293
   03400 DNA repair and recombination proteins [BR:osa03400]
    4339293
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     4339293
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    4339293
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     4339293
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     4339293
SSDB
Motif
Pfam: BRCT BRCT_2 zf-C3HC4_2 zf-HC5HC2H zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4 zf-RING_5 zf-C3HC4_4 zf-RING_6 zf-HC5HC2H_2 RTT107_BRCT_5 PTCB-BRCT zf-RING_10 Prok-RING_4 zf-Nse
Other DBs
NCBI-GeneID: 4339293
NCBI-ProteinID: XP_015638240
LinkDB
Position
5:complement(25357201..25362848)
AA seq 993 aa
MADTGSLEKMGRELKCPICLSLLSSAVSISCNHVFCNDCLTESMKSTSSCPVCKVPFRRR
EMRPAPHMDNLVSIFKSMEAAAGTNVVSTQEAPVVKLADGSDCVNSGKNSKRSQKSLTRK
RKVTSEMEKNTAKDATASASQPTTKPSFSTNKRIQVKPFPESETPIRAEKIMKPEEPKNN
LNNDVEGKNKAVASGQPGSPSLSPFFWLREQEEQEGCTAETLSETQSLDTPLRHNAPSFS
DIKDSDDEIPLNTTPNSKAAATELFDSEIFEWTQRPCSPELYSTPLKKQSKAKSKLDQIE
EKGDEEDVHIGGSFDKLGNASNAAQLVNTKATKQKRKKTSPSNKNSAKLSNRAEPCIKKS
DANQQGSNRRKSAALKSCQKSSSAVGRNTSGRRNKASSNSKPIHGSSDNSPESYLPKEGL
DVEAPDKPLSERIQNLEKTSRRKGSARKLEMAGKTISDTTEKNSEPRSKRVRRMSDHAIA
KPVEVPSGSGNETEIPQLHTLTKGSIQRKSSNARRHSKVCGEQEGKNKLENTTMTPIILH
GKCQNKEAVCTAPSVRTASVKYKQAKFSEQPDCFGTENFGNLQACPARNVLLKKCEVSTL
KVSCAFCQTDVITEESGEMVHYQNGKQVPAEFNGGANVVHSHKNCLEWAPDVYFEDDSAF
NLTTELARSRRIKCACCGIKGAALGCFEMSCRRSFHFTCAKLIPECRWDNENFVMLCPLH
RSTKLPNENSEQQKQPKRKTTLKGITGFSRSSQIGSNQDCGNNWKWPSGSPQKWVLCCSS
LSSSEKELVSEFAKLAGVPISATWSPNVTHVIASTDLSGACKRTLKFLMAILNGRWIVSI
DWVKTCMECMEPIDEHKFEVATDVHGITDGPRLGRCRVIDRQPKLFDSMRFYLHGDYTKS
YRGYLQDLVVAAGGIVLQRKPVSRDQQKLLDDSSDLLIVYSFENQDRAKSKAETKAADRR
QADAQALACASGGRVVSSAWVIDSIAACNLQPL
NT seq 2982 nt   +upstreamnt  +downstreamnt
atggcggacacggggagcctggagaagatggggcgagagctcaagtgccccatctgcctg
agccttctcagttcggcggtatccatctcctgcaaccacgtcttctgcaatgattgcctc
acggaatcgatgaaatccacgtcgagctgccccgtgtgcaaggtcccgttccgacgacga
gaaatgcgaccagcacctcacatggacaatctggtcagcattttcaaaagcatggaggct
gcagcaggtaccaatgttgtctcaacacaggaggctcctgtggtaaaacttgcagatgga
tcagattgtgtcaacagcgggaaaaattccaaaaggtcacaaaaatcattgacacgaaaa
aggaaggtaacatccgagatggaaaaaaatacagcaaaggatgctacagcttctgcatcc
caacctactacaaagccttccttctctactaacaaaagaatacaagtgaaaccattccct
gaatctgagacaccaataagagctgagaagattatgaagcctgaagagccaaaaaataat
ctgaataatgatgttgaaggaaagaataaagcagtggcatcgggtcaacctggaagtcct
tcattgtcaccctttttttggctaagggaacaagaagaacaagaaggctgtaccgctgag
acgttaagtgaaacgcaatctttagacacacccttgcgtcataatgcaccctcttttagc
gatattaaagattctgatgacgaaatccctttaaatacaactccaaatagcaaagctgcg
gctacagaactctttgacagtgaaatatttgaatggacccagagaccatgctctcctgaa
ttgtattccactccattgaaaaagcagagtaaagctaagagtaaactagatcaaattgaa
gagaagggtgatgaagaagatgtgcatattggtggttcatttgataagctgggtaatgca
agtaatgcagctcagcttgtcaatacaaaagcaacaaagcagaagagaaagaaaacaagt
cccagtaacaaaaacagtgcaaaattgtccaatcgtgctgagccctgcataaaaaagtct
gatgccaatcaacaaggttcaaatagacgtaaaagtgctgccctaaaatcttgtcagaaa
agcagcagtgctgtagggaggaatacttcaggtagaagaaacaaggcctctagcaacagc
aagccaattcatggctctagtgataactccccagagtcatatcttcctaaggagggtttg
gatgttgaagcacctgacaaacccctttctgaaaggatccaaaacttggagaaaactagt
cgacgaaagggaagtgcaaggaagctggaaatggcagggaaaactatttcagatactaca
gagaagaatagtgagccaagaagtaagagagtcagaagaatgtctgaccacgctatagct
aaaccggttgaagttccttcaggatctggaaatgaaacagaaataccacagcttcacacc
ctcacaaaaggcagcattcaacgcaaatcctccaacgctagaagacatagcaaagtttgt
ggagaacaggaaggtaagaataaacttgagaacacgacaatgacacctattattttacat
gggaaatgccaaaataaagaggcagtatgtacagctccttcagtaaggactgcatctgtt
aagtacaagcaagcaaaatttagcgaacaaccagattgttttggaacggagaactttgga
aaccttcaagcatgccctgcacgtaatgttttactgaagaagtgtgaggtatctactttg
aaggtttcctgtgctttctgccagaccgatgtcatcacagaggagtctggagagatggtt
cattatcaaaatgggaaacaagtccctgcagagttcaatggaggagccaatgtggtgcac
tctcacaagaactgccttgagtgggctcctgatgtctacttcgaagatgattctgccttt
aatcttacaactgaattggcgagaagcagacggatcaaatgtgcttgctgtggaattaaa
ggagctgcacttggatgctttgagatgagttgtcggagaagtttccacttcacctgtgct
aaactaatcccagaatgcagatgggataatgaaaattttgtgatgttatgccctctacat
cggtctacaaagttacccaatgaaaattctgaacagcaaaagcaacctaaaaggaaaaca
acactcaaaggaataaccggcttttccaggtcatctcaaataggatccaatcaagattgt
ggtaataactggaaatggccatctggatcaccacagaagtgggttctctgctgctcatca
ctttctagttctgagaaggaacttgtatcagaatttgcaaagttagctggcgtgcctatt
tcggcaacttggagtccaaatgttacccatgttattgcatcaactgatctctctggtgct
tgcaaacggacgctgaagtttctcatggcaatcttgaatggcagatggattgtctccata
gattgggttaaaacttgcatggagtgcatggaaccaattgatgagcacaaatttgaagtc
gctactgatgttcatgggatcactgatggtcctaggttaggaagatgcagggttattgac
aggcaacctaagctgttcgacagcatgaggttctacctccatggggactacacaaaatcc
tacagaggctacctgcaagatctcgtggttgcagcaggtggaatagttcttcagaggaag
cccgtatcaagagaccagcaaaagcttcttgatgacagctctgacctcctcatcgtttac
agcttcgagaatcaagatagggcaaaatccaaggccgaaaccaaggctgctgatcgcagg
caggctgatgctcaggctcttgcttgcgcttctggaggcagagttgtgagcagtgcatgg
gtgattgactcaattgcagcctgcaatctgcaacctctttga

DBGET integrated database retrieval system