KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276043
Entry
107276043         CDS       T01015                                 
Name
(RefSeq) putative mannan endo-1,4-beta-mannosidase 5
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    107276043
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     107276043
SSDB
Motif
Pfam: Cellulase
Other DBs
NCBI-GeneID: 107276043
NCBI-ProteinID: XP_015638320
LinkDB
Position
5:14816121..14818824
AA seq 546 aa
MISLSLSLSLLLPSQDDPVLLTDCTYMDLIKLSSHASLRYKLQPCGASPPAAAAAMETSY
REEEARRKASLLHCIFFFLLGALAMAAAIAVLHESSYWEWRCNRLTDIVVDGDDGDGPSS
SEVVDGGGEWGMVRTRGAQFVVGGGRPFYVNGFNTYWLMVLAVDPSTRGKVTEVFRQAAA
VGLTVCRTWAFNDGGWRALQKSPGVYDEEVFKALDFVVSEARKHKIRLILPLINNWDDYG
GKAQYVRWAQAAAAGAGADAFFSDETVRGYFKSHVTAVLTRVNAYTGVAYRDDPTIMAWE
LMNEPRCASDPTGDTLQAWIAEMAFHVKSVDPAHLLGVGAEGFYGPSSPPARLRVNPNAD
VALAGADFVRNHRVLGVDFASVHVYPDTWLPAGATKEAQLRFATSWVEAHIADAEGALGG
MPVLFAEFGVSTRGARAAFNATSRDAFIEAVYGAMLRSTRRGGGGAGALLWQVFPEGTDY
MDDGYAVVLPRAAATAGIVAAHSRRLQSFNSRCAWSCRWGCNKRDNDTAETTTAEADVDV
SFHHEL
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgatctctctctctctctctctctctctgttgcttccaagccaagacgaccctgtcttg
ctcactgactgtacgtacatggatctcatcaagctcagctcccatgcctccctccggtat
aaattgcagccatgtggagcttcaccaccggcggcggcggcggccatggagacgtcgtac
agggaggaagaagcgaggaggaaggcatccctgctccactgcatcttcttcttcctcctc
ggagctctcgccatggccgcagcgatcgccgttctacacgagtcatcatactgggagtgg
cgctgtaatcgcctcaccgacatcgtcgttgacggcgacgacggcgatggtccgagcagc
agcgaggtggtcgacggcggcggcgagtgggggatggtgaggacgaggggcgcgcagttc
gtcgtcggcggcggccggccgttctacgtgaacgggttcaacacgtactggctgatggtc
ctcgccgtcgacccgtcgacgagggggaaggtcaccgaggtgttccggcaggcggcggcg
gtcgggctcacggtttgccggacgtgggcgttcaacgacggcgggtggcgggcgctccag
aagtcacccggagtctacgacgaggaggtcttcaaggccctggatttcgtggtgagcgag
gcgcggaagcacaagatcaggctgattcttccgctgatcaacaactgggacgactacggc
ggcaaggcgcagtacgtgcggtgggcgcaggccgccgccgccggcgccggcgccgacgcc
ttcttctccgacgagaccgtgaggggctacttcaagagccacgtcacggcggtgctgacg
agggtgaacgcgtacacgggcgtggcgtacagggacgacccgaccatcatggcgtgggag
ctcatgaacgagccgcgctgcgcctccgaccccaccggcgacacgctccaggcgtggatc
gcggagatggcgttccacgtcaagtccgtcgacccggcgcacctgctcggcgtcggcgcc
gaggggttctacggcccgtcctcgccgccggcgcgcctccgggtgaaccccaacgccgac
gtcgccctcgccggcgccgacttcgtccgcaaccaccgcgtcctcggcgtcgacttcgcc
tccgtccacgtctacccggacacttggctgccggcgggcgcgacgaaggaggcgcagctg
aggttcgcgacgtcgtgggtggaggcgcacatcgcggacgccgagggcgcgctcggcggc
atgccggtgctgttcgcggagttcggggtgtccacgaggggcgcccgggcggcgttcaac
gcgacgtcgagggacgcgttcatcgaggcggtgtatggcgcgatgctgcggtcgacgcgg
cgcggcggcggcggcgcgggggcgctgctgtggcaggtgttcccggagggcacggattac
atggacgacggctacgccgtcgtgctgccccgggcggcggccaccgccgggatcgtggcg
gcgcactccaggcggctgcagtcgttcaactcccggtgcgcgtggagctgccgctggggc
tgcaacaagagggacaacgacacggctgagacgacgacggcggaggctgacgtcgacgtg
tccttccaccacgaactgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326178
Entry
4326178           CDS       T01015                                 
Name
(RefSeq) mannan endo-1,4-beta-mannosidase 2
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4326178
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     4326178
SSDB
Motif
Pfam: Cellulase Glyco_hydro_cc Glyco_hydro_42 Glyco_hydro_2_C
Other DBs
NCBI-GeneID: 4326178
NCBI-ProteinID: XP_015626424
UniProt: Q0JJD4
LinkDB
Position
1:complement(31252438..31254928)
AA seq 445 aa
MAVGNGLILYHILGLASCIALVYFSLGEVDLRDALPSLPFSGGASRAAAASLPFVERRGK
RLFLDGRPFYINGWNSYWLMDLAVEPNTRPRVSSMFRTAVSMGLTVCRTWAFNDGSYNAL
QLSPGHFDERVFKALDRVVAEASEHGVRLILSLANNLDAYGGKRQYVRWAWEEGVGLTAS
NDSFFFDPAIRDYFKVYLKTLLMRKNHLTGLEYRDDPTILAWELMNEPRCTSDPSGDTLQ
RWMEEMSAYVKSIDKKHLLTVGTEGFYGPTSSQEKLNINPGEWFPNNYGADFIRNSKIQD
IDFASVHVYPDNWLQHASLDEKLKFMTRWITAHVEDGDGELEKPVLVTEFGLSHQVEGFE
DAHRDVLYRAVYDIVHGSARRGGAAGGALVWQLAAEGMEEYHDGFSIVPSERPSMMRLIK
EQSCRLAAVRYGEEGARKVLKTVCA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcggtgggcaacggcctgatcctgtaccacatcctcgggctggcctcctgcatcgcg
ctggtctacttctccctcggcgaggtggacctccgcgacgccctgccatccctcccgttc
tcgggcggcgcctcgcgcgcggcggcggcgtccctgcccttcgtggagcggcgcggcaag
cgcctcttcctggacggccggcccttctacatcaacgggtggaactcgtactggctcatg
gacctcgccgtggagccgaacacccgcccccgcgtgtccagcatgttccgcaccgccgtc
tccatgggcctcaccgtgtgccgcacctgggccttcaacgacggctcctacaacgccctc
cagctctcccccggccacttcgacgagcgcgtcttcaaggcgctggaccgggtggtggcg
gaggcgtcggagcacggcgtgcggctgatcctgagcctggcgaacaacctggacgcgtac
ggcgggaagcggcagtacgtgcggtgggcgtgggaggagggcgtcggcctcaccgcctcc
aacgattccttcttcttcgaccccgccatccgcgactacttcaaagtctacctcaagacg
ttgctgatgaggaagaatcacttgacggggttggagtacagggacgaccctaccatcctc
gcgtgggagctcatgaacgagcccagatgcacctccgatccatctggtgacactctgcag
cgttggatggaggagatgtctgcgtacgtgaaatcgatcgacaagaagcacctcctcacc
gtcggcaccgaggggttctacggcccgacgagttctcaagaaaagctgaacatcaatccg
ggagaatggttccccaacaactacggcgcggatttcatccgcaactccaaaatacaagac
atcgactttgcttccgtccatgtttacccagacaattggttgcagcacgccagtctggac
gagaagctcaagttcatgacgcggtggatcaccgcccacgtggaggacggcgacggggag
ctggagaagcccgtgctggtgacggagttcgggctgtcgcaccaggtggagggcttcgaa
gacgcgcaccgggacgtcctgtacagggcggtgtacgacatcgtccacggctcggccagg
cggggcggcgccgccggcggcgcactcgtgtggcagctcgccgccgagggcatggaggag
taccacgacggcttctccatcgtacccagcgagaggccgtccatgatgcggctgatcaag
gagcagtcgtgccggctcgccgcggtgaggtacggcgaggagggggccaggaaggtcctc
aagacggtgtgcgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327860
Entry
4327860           CDS       T01015                                 
Name
(RefSeq) mannan endo-1,4-beta-mannosidase 1
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4327860
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     4327860
SSDB
Motif
Pfam: Cellulase Glyco_hydro_42
Other DBs
NCBI-GeneID: 4327860
NCBI-ProteinID: XP_015621908
LinkDB
Position
1:27081730..27085664
AA seq 489 aa
MAPHELQLFIAAFTSLQVPFFHLASPHRHCHPKQRREPPCRHSTHTQREREREREQGMRL
LGAHRAALLVLACVVVVVIHGLGEAEALGGGGGFVRAQGTRFVLDGNPYYANGFNAYWLM
LLAADPSQRGKVSAALGEAAGHGLTVARTWAFSDGGGGNALQLSPGNYNENTFKGLDFVL
SEARKYGIKVILSLVDNYDSFGGRKQYVNWARAQGQGIGSDDEFFTNPVVKGFYKNHVKT
VLTRKNTITGVAYRDDPTILAWELMNEPRCQSDLSGRTVQSWITEMAAHVKSIDRNHMLE
VGLEGFYGASSPSRIAAVNPSGYQLGTDFIANNQVPGIDFATVHSYPDQWLSGKDDQAQL
GFMGRWLDAHIADAQAVLRKPLLIAEFGKSWKDPGYSSGQRDALYGTVYAKIYESARRGG
ATVGGLFWQLLVPGMDSYRDGYEVVFGETPSTTGVITTNSRRLRFLSKAFARARQAQPAR
GKGRHNGGK
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcgccccatgagttgcagctatttatcgcagccttcacctccttgcaagttccattc
tttcatctcgcttcacctcatcgccattgccatccaaagcaaagaagagagccaccctgc
agacacagtacgcacacgcagagagagagagagagagagagagagcaagggatgaggctt
ctcggagctcatcgtgctgctctgctggtgctcgcgtgcgtcgtcgtcgtcgtcatccat
ggcctaggagaggcggaggccttgggaggagggggcggcttcgtgagggcgcaggggaca
cggttcgtgctcgacggcaacccgtactacgccaacgggttcaacgcctactggctcatg
ttgctggccgccgacccgtcgcagaggggcaaggtcagcgccgcgctcggcgaggccgcc
gggcacggcctcaccgtcgccaggacgtgggcgttcagcgacggcggcggcggcaacgcg
ctgcagttgtcccccggcaactacaacgagaacaccttcaagggtttggattttgtgctg
tctgaggctaggaagtatgggatcaaggtgatactgagccttgtggacaactacgactct
tttggcgggaggaagcagtatgtgaactgggcaagagcgcaggggcagggcattgggtcc
gacgatgagttcttcaccaaccctgttgttaagggcttctacaagaaccacgtgaagacg
gtgttgacgaggaagaacacgatcacgggggtggcgtacagggacgacccgaccatcctg
gcgtgggagctgatgaacgagccgaggtgccagtccgacctgtccggccgcaccgtccag
tcgtggatcaccgagatggcggcgcacgtcaagtccatcgaccgcaaccacatgctggag
gtcggcctcgagggcttctacggcgcctcctcgccgtcccgcatcgccgccgtcaacccc
tccggctaccagctcggcaccgacttcatcgccaacaaccaggtccccggcatcgacttc
gccaccgtccactcctaccccgaccaatggttgtcgggcaaggacgaccaggcgcagctg
gggttcatggggaggtggctggacgcgcacatcgcggacgcgcaggcggtgctgaggaag
ccgctgctgatcgcagagttcggcaagtcgtggaaggacccgggctacagcagcgggcag
cgggacgcgctctacggcacggtgtacgccaagatctacgagtcggcgcggaggggcggc
gccacggtggggggcctcttctggcagctcctggtgcccggcatggactcgtaccgcgac
ggctacgaggtcgtcttcggtgagacgccgtccaccacgggcgtcatcaccacgaacagc
cggcggctgcgcttcctcagcaaggcgttcgcgcgggccaggcaggcccagccggcgagg
gggaagggccgacacaacggcgggaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330839
Entry
4330839           CDS       T01015                                 
Name
(RefSeq) putative mannan endo-1,4-beta-mannosidase 9
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4330839
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     4330839
SSDB
Motif
Pfam: Cellulase Glyco_hydro_42
Other DBs
NCBI-GeneID: 4330839
NCBI-ProteinID: XP_015624964
LinkDB
Position
2:complement(32283950..32285647)
AA seq 409 aa
MGSKRRVILLPTLGVVVLAIAAAVLLHAGEAADVANGQFARASGTRFTVGGRPFYSNGFN
AYWLMYMASDPGDRSKAAGVLQQAASLRATLVRTWAFSDGGYRPLQKSPGVYNEDMFMGL
DFVIAEAKKRGLYLILSLVNNWDGFGGKKQYVQWARDQGHNLGSDDDFFRSDVTKQFYKN
HVKAVLTRVNKITGVAYKDDPTIFAWELINEPRCQSDLSGKTLQAWVTEMAGYVKSVDPN
HMVEIGLEGFYGESMHKNFNPGYTVGTDFIANNLVPAVDFATIHSYPDQWVSGASSDEQV
AFMRKWMADHIRDSAAVLRKPLLVTEFGWSARSNGYTVAARDAYFRTVYDAVYASAREGG
ACAGGLFWQVMAPGMESWTDGYEVVLERSKSTADVVAHQCARIAGLSPA
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggggagcaaacggcgagtaatcttgctgccaactttgggcgtcgtcgtcctggccatc
gcggcagccgtcctcttgcacgccggcgaggcggccgacgtcgccaacgggcaattcgcg
agggcgagcgggacgcggttcacggtgggtggccggccgttctactcgaacggcttcaac
gcgtactggctcatgtacatggcgtccgaccccggcgaccggagcaaggcggccggcgtc
ctccagcaggcggcgagcctccgcgcgacgctggtgaggacgtgggcgttcagcgacggc
ggctaccggccgctgcagaagtcccccggcgtgtacaacgaggacatgttcatgggacta
gattttgtgatagccgaagcgaagaaacgagggctgtatctgatactgagcctggtgaac
aactgggacggattcggcgggaagaagcagtacgtgcagtgggctagggatcagggacac
aacctgggctctgacgacgacttcttccggagcgacgtgaccaaacagttctacaaaaac
catgtcaaggccgtcctgaccagagtgaacaagataaccggagtggcgtacaaggacgat
ccgaccatctttgcatgggagctcatcaacgagcctcgctgccagagcgacctctccgga
aaaacacttcaggcttgggtcacggagatggccgggtacgtgaaatccgtggatccgaac
cacatggtggagatcgggctggaagggttctacggcgagtcgatgcacaagaacttcaac
ccgggctacaccgtcggcaccgacttcatcgccaacaacctcgtccccgctgtcgacttc
gccacgatccactcctaccccgaccaatgggtgtccggcgcgagcagcgacgagcaggtg
gcgttcatgaggaagtggatggccgaccacatccgcgactcggcggcggtgctccggaag
ccgctgctggtgacggagttcgggtggtcggcgaggtcgaacgggtacacggtggcggcg
cgggacgcctacttccgcacggtgtacgacgcggtgtacgcgtcggcgcgggagggcggc
gcgtgcgccggtggcctcttctggcaggtgatggcgcccgggatggagagctggaccgac
ggctacgaggtggtgctcgagcgcagcaagtctacggccgacgtcgtcgctcaccagtgc
gccaggatcgccggactcagcccggcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334653
Entry
4334653           CDS       T01015                                 
Name
(RefSeq) mannan endo-1,4-beta-mannosidase 4 isoform X1
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4334653
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     4334653
SSDB
Motif
Pfam: Cellulase Glyco_hydro_cc Chalcone Glyco_hydro_42
Other DBs
NCBI-GeneID: 4334653
NCBI-ProteinID: XP_015628087
UniProt: Q10B67
LinkDB
Position
3:34797438..34800852
AA seq 461 aa
MSSCALVQRPPPWRAAVAPGDGMVAVDGTQFVVDCGRTIFFSGFNAYWLMMMAADPALRG
AVATAFQQASAHGLNLARTWAFSDGGDQPLQSSPGVYNETMFQGLDFVIAEARRHGIYLL
LCLTNNFDNFGGKRQYVRWAGDAGHNLTSDDDFFTSTIVKSYFKNHVKTVLTRVNTLTGV
AYKDDPTIFAWELMNEPRCYADPTGAMVQAWVEEMAPYVKSVDGRHLVTPGLEGFYGAGE
HESKELNPWGIYYGTNYVATHRTAAVDFATIHLYPDVWLWGSSADEQATFFRNWTRSHID
ATAAYLGMPLLVTEYGKFLWKEVGANKAQRNYFLDLVLDAIYASASRGGPLVGGAFWQLL
LDGDIVAGMDSLRDGYEIILAEDSRAASIIGEHSEQLAALNGQDADVLCRRASSHRRTRL
GNSLSCGGGDTLELLLRMVLACFVSLSRSISSFIVQNFILL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagttcttgcgctttagttcaaagacctccaccctggcgcgctgccgtggcgcctggc
gatggcatggtggccgtggacggcacgcagttcgtggtggactgcggcaggacgatcttc
ttcagcgggttcaacgcgtactggctgatgatgatggcggccgacccggcgctgcgcggc
gcagtggcgacggcgttccagcaggcatcggcgcacgggctcaacctggcaagaacgtgg
gccttcagcgacggcggcgaccagccgctgcagtcgtcgccgggcgtctacaacgagacc
atgttccaggggctggactttgtgatcgccgaagcaaggcggcacggtatataccttctc
ctctgcctgaccaacaactttgacaattttggaggcaagcggcagtacgtgcggtgggcg
ggggacgccggccacaacctcacctccgacgacgacttcttcaccagcaccatcgtcaag
tcctacttcaagaaccacgtcaagacggtgctgacgagggtgaacaccctgacgggcgtg
gcgtacaaggacgaccccaccatcttcgcctgggagctcatgaacgagccgcgatgctac
gccgacccaaccggcgccatggtgcaggcgtgggtggaggagatggcgccgtacgtgaag
agcgtcgacggccggcacctggtgacacccgggctggaggggttctacggcgccggcgag
cacgagagcaaggagctcaacccgtggggcatctactacggcaccaactacgtcgccacg
caccgcaccgccgccgtcgacttcgccaccatccacctctacccggacgtctggctatgg
ggctccagcgccgacgagcaggccactttcttccggaactggacgcgctcccacattgac
gccacggcggcgtacctcggcatgccgcttctcgtcaccgagtacggcaagttcctctgg
aaggaggtcggcgccaacaaggcgcagaggaactacttcctcgacttggtgctcgacgcc
atctacgcctcggcatcgcgcggtggcccgctcgtcggcggcgcgttctggcagctgctg
ctcgacggtgacatcgtcgctggcatggacagcctcagggacgggtacgagatcatactc
gccgaggacagccgcgccgcgagcatcatcggcgagcactcggagcagctggctgccctc
aatggccaggacgcggatgtgctttgccgccgggcaagctctcaccggaggacgcgtcta
ggcaactcgcttagctgcggcggcggcgacacccttgaactgctcctccggatggtcttg
gcttgtttcgtctctttgtccagatcgatctcttcatttattgtacagaatttcattctt
ttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340863
Entry
4340863           CDS       T01015                                 
Name
(RefSeq) mannan endo-1,4-beta-mannosidase 6
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4340863
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     4340863
SSDB
Motif
Pfam: Cellulase Glyco_hydro_2_C Glyco_hydro_42
Other DBs
NCBI-GeneID: 4340863
NCBI-ProteinID: XP_015640965
UniProt: Q0DCM5
LinkDB
Position
6:11877508..11881879
AA seq 440 aa
MRQERRLYSLLGLLLLLAVVYLTWFPTTHDGGGGGGGGWVKLPVPWLQPRMPFAARRGTH
FVDADTGSPLYVNGWNSYWLLPARSPALAAEMLRRGRRMGLSVCRTWAFSDGGPGALQIS
PGRFSEAVFQVLDYVIYEARRNHIRLILCLVNNLDNLGGKAQYVQWAQAAGANMTNSTDS
FYSHPTIKRYYKDYVKAILTRRNSYSRIRYSDEPAIFAWELMNEPRCVSNSSGPYLQAWI
AEMAAYVKSLDTNHLVTVGTEGFYGPGIAERLGVNPGEWAASLCSDFIQNSAVEHIDFAS
VHAYPDSWLPRASLEEKVRYLSNWVDSHLNDSEQILKKPVLFTEVGYLQHSDANSNSTVD
RDIILRIVYDKIYDSARKLQAGSGALIWQLMVEGTHMYGDNFSVVARDRPSTYSLITNQS
CRLQRLYGEGDPGWQCSIPP
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcggcaggagaggcggctgtacagcctcctcggcctcctcctcctcctcgccgtcgtc
tacctcacctggttcccgacgacccacgacggcggcgggggcggtggtggggggtgggtc
aagctgccggtgccgtggctccagccgcggatgcccttcgcggcgcgccgcggcacccac
ttcgtcgacgccgacacggggtcgccgctctacgtcaacggctggaactcctactggctc
ctccccgcgcggtccccggcgctcgccgccgagatgctgcgccggggacgccggatgggg
ctctccgtctgccgcacctgggcgttcagcgacggcggccccggcgcgctccagatctcc
cccggccgcttcagcgaggccgtcttccaggtattggattatgtcatatatgaagcccgg
agaaatcatattagattgattctttgccttgtgaacaacctcgataaccttggagggaag
gctcaatatgtccagtgggcacaagcagctggagctaatatgacaaattcaactgattct
ttttattcacatccaactattaagcgttactacaaggattatgtgaaggcaatattgacc
agaagaaactcttacagtcgaataagatactctgatgaacctgctatatttgcttgggaa
ctcatgaatgagcctaggtgtgtgtccaactcatctggcccctaccttcaggcttggatt
gcagagatggctgcatatgtaaaaagtttggacactaatcatctagttacagttggaact
gaagggttttatggtcctggaatagctgaaagactgggtgttaatcccggggaatgggca
gcttcactttgctcagacttcatacaaaactcagcagttgaacatattgattttgcttct
gttcatgcttatcccgatagctggttaccaagggcaagcttggaagaaaaagtcagatat
ctttccaattgggttgattcacacctgaatgacagtgaacaaatcttgaaaaaacctgtc
ctatttacagaagtaggctacctccagcattcagatgcaaacagtaacagcacagttgat
agagacattattctaagaattgtttatgataaaatctatgattcggcaagaaagctgcag
gcgggtagtggtgctcttatctggcagttgatggttgaaggaacacacatgtatggtgat
aatttctccgttgtggcacgggatcgtccctcgacttatagtttgataaccaatcagtca
tgtcgtttgcaaaggctgtatggagaaggagaccctgggtggcaatgctcaataccaccc
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349615
Entry
4349615           CDS       T01015                                 
Name
(RefSeq) mannan endo-1,4-beta-mannosidase 7
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4349615
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     4349615
SSDB
Motif
Pfam: Cellulase Glyco_hydro_cc Glyco_hydro_2_C Glyco_hydro_42
Other DBs
NCBI-GeneID: 4349615
NCBI-ProteinID: XP_015616432
UniProt: Q2RBB1
LinkDB
Position
11:complement(821011..823221)
AA seq 379 aa
MEDAHHHHWTMVERRGTQLWASGRPFIIHGFNTYWLMSFAADQATRLRVTAAIAEAGLNV
CCTWAFSDGGYRALQTAPFHYDEDVFRALDFVVSEARRHNMRLILSLCNNWEDYGGKAQY
VRWGKEAGLDLTSEDDFFSDPTIKSYYKAFVEAVVTRINTVTNETYKDDPTILAWELINE
PRCPSDPSGDTLQAWMEEMASYVKSIDPVHLLEIGIEGFYGPSIPELLPVNPDEYSGHAG
IDFIRNHQAPGIDLASIHVYSDIWLPQSIKENHLQFVDKWMQQHIDDAANLLGMPIVVGE
FGVSVKDGKFGNEFREDFMKTIYRIFLSSWKEGVIGGGCLLWQLFPEGAEHMDDGYAVIF
AKSPSTLSLLANHLRCLEC
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggaagacgcccaccaccaccactggacaatggtggagcgccgcggaactcagctctgg
gcctccggccgccccttcatcatccacggcttcaacacctactggctcatgtcattcgct
gctgaccaagccacgcgcctgcgggtcaccgccgccatcgccgaggccggcctcaacgtc
tgctgcacctgggccttcagtgacggcggttaccgcgcgctgcagacggcacccttccac
tacgacgaggatgtcttccgggccttagactttgtggtcagcgaggcaagaaggcataac
atgaggttgatactgtcactttgtaacaactgggaagattatggagggaaggcacagtat
gtgagatggggaaaagaggctggtctagatcttacttctgaagatgacttcttctctgac
ccaacaattaagagctactacaaagcttttgttgaggctgttgtgacaagaataaacacg
gttacgaatgaaacctacaaagatgatcctactattcttgcctgggagctaattaatgag
ccacgctgcccttcagatccatctggagatactttgcaggcatggatggaagagatggca
tcttatgtgaagagtatagaccctgtgcatctcttggagattggtatagaaggcttttat
ggcccatccattccagaacttttgcctgttaacccagatgagtattcagggcatgctgga
atagacttcatcaggaaccatcaagcacctggaattgacctggcgtctattcatgtttat
tctgacatttggctgcctcaatcgataaaggaaaatcaccttcaatttgtggataaatgg
atgcaacaacatattgatgatgcagccaatttacttgggatgccaattgtggttggggag
tttggggtatcagttaaggacgggaagtttggtaatgaattccgtgaagatttcatgaag
acaatttacagaattttcttgagttcttggaaggaaggagtgattggaggaggttgcctt
ctttggcagcttttccctgaaggagcagagcacatggatgatggttatgcagttattttt
gcaaaatcaccatccacattaagcttacttgcaaatcacttaaggtgtctggaatgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266557
Entry
9266557           CDS       T01015                                 
Name
(RefSeq) mannan endo-1,4-beta-mannosidase 3
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    9266557
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     9266557
SSDB
Motif
Pfam: Cellulase Glyco_hydro_cc Glyco_hydro_42
Other DBs
NCBI-GeneID: 9266557
NCBI-ProteinID: XP_015629243
LinkDB
Position
3:34792003..34793877
AA seq 535 aa
MDASCRRRSPPLSTYYFHLINVHLLGSAHAPIYIKNAHEFDRVAYLHEQVTSVVEVQGAS
CATHMAAMTVRPRPAAAAIIIAAVFGAAAAAAGGGMVGVDGTQFVVEGGRTIYFSGFNAY
WLMMMASDPARRAAVVAAFAQASSRGLNLARTWAFSDGGDQPLQSSPGVYDEAMFQGLDF
VIAEARRHGIYLLLCLTNNFDDFGGKRQYVRWAADAGHNLTAGDDFFTSSVVKSYYKNHV
KAVLTRVNTVTGVAYKDDPTIFAWELMNEPRCDADPTGGMVQAWVEEMAPYVKRVDGGRH
LVTAGLEGFYGDGEHESKELNPWGIYYGTNYVATHRAAGVDFATIHLYPDVWLWGSTADE
QAAFFRNWTRSHVHDTAAFLGKPLLVTEYGKFLWKGGGANKTQRNYFLDVVLDAIYASAS
RGGPLVGGAFWQLLLDDDVVAGMDDLRDGYEIILAEDSRAASIIGEHSEQLASLNGQDAE
ALRRRRRRPASSHRKTRLGSGGDSDALRLPRTLLIRFISLSRSISSFIQDNFVLF
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggacgctagctgccggcgacgatcaccaccgttgtccacgtactacttccatctaatt
aacgtgcatcttctaggctctgctcatgcgcctatatatataaaaaacgcacacgaattc
gatcgcgttgcatatttgcatgaacaagtcacaagtgtagtagaagtgcagggcgcaagc
tgtgcaacacacatggcggcgatgacggtgaggccacggccggccgccgccgcgatcatc
atcgccgccgtcttcggcgccgccgcggcggcggcgggcggcggcatggtgggcgtggac
gggacgcagttcgtggtggagggcggcaggacgatctacttcagcgggttcaacgcgtac
tggctgatgatgatggcgtccgacccggcgcgccgcgccgccgtcgtcgccgcgttcgcc
caggcgtcatcgcgcggcctcaacctcgcccggacctgggccttcagcgacggcggcgac
cagccgctgcagtcgtcgccgggcgtctacgacgaggccatgttccaggggctggacttt
gtgatcgccgaggcgagacgacatggcatataccttctcctctgcctcaccaacaacttc
gacgatttcggcggcaagcgtcagtacgtccggtgggcggccgacgccggccacaacctc
accgccggcgacgacttcttcaccagctccgtcgtcaaatcctactacaagaaccacgtc
aaggcggtgctgacgagggtgaacacggtgacgggggtggcgtacaaggatgatccgacg
atcttcgcgtgggagctcatgaacgagccgcggtgcgacgccgacccgacgggcggcatg
gtgcaggcgtgggtggaggagatggcgccgtacgtgaagcgcgtcgacggcggccgccac
ctggtgacggccgggctggaggggttctacggcgacggcgagcacgagagcaaggagctc
aacccgtggggcatctactacggcaccaactacgtggccacgcaccgcgccgccggcgtc
gacttcgccaccatccacctctacccggacgtctggctatggggctccaccgccgacgag
caggccgccttcttccgcaactggacgcgctcccacgtccacgacacggcggcgttcctc
ggcaagccgctgctcgtcaccgagtacggcaagttcctctggaagggcggcggcgccaac
aagacgcagaggaactacttcctcgacgtggtgctcgacgccatctacgcctcggcgtcg
cgcggcggcccgctcgtcggcggcgcgttctggcagctgctcctcgacgacgacgtcgtc
gccggcatggacgacctcagggacgggtacgagatcatactcgccgaggacagccgcgcc
gcgagcatcatcggcgagcactccgagcagctggccagcctcaacggccaggacgcggag
gcgcttcgccgccgccgccggcggccggcgagctcgcaccggaagacgcgtcttggcagc
ggcggcgacagcgacgcactccgactcccccgaacgctcttgattcgcttcatctctttg
tctagatcgatctcttcatttattcaagacaattttgttcttttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271116
Entry
9271116           CDS       T01015                                 
Name
(RefSeq) mannan endo-1,4-beta-mannosidase 8
  KO
K19355  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    9271116
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     9271116
SSDB
Motif
Pfam: Cellulase Glyco_hydro_2_C Glyco_hydro_cc Glyco_hydro_42
Other DBs
NCBI-GeneID: 9271116
NCBI-ProteinID: XP_015620164
UniProt: A0A8J8YKJ9 B9GBJ3
LinkDB
Position
12:complement(858268..860949)
AA seq 382 aa
MEDAHHHHWTMVECSGTQLWASGRPFIIHGFNTYWLMSFAADQATRPRVTAAIAEAAEAG
LNVCRTWAFSDGGYRALQTVPFHYDEDVFQALDFVVSEAKRHNMRLILSLCNNWEDYGGK
AQYVRWGKEAGLDLTSEDDFFSDPTIKSYYKAFVEAVVTRINTVTNETYKDDPTILAWEL
INEPRCPSDPSGDTLQAWIEEMASYVKSIDPVHLLEIGIEGFYGLSTPELLPVNPDEYSG
HAGTDFIRNHQAPGIDLASIHVYSDTWLPHSIKENHLQFVDKWMQQHIHDAANLLGMPIV
VGEFGVSVKDGKFGNEFREDFMKTVYRIFLSSWKEGVIGGGCLLWQLFPEGAEHMDDGYA
VIFAKSPSTLSLLANHLRCLEC
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaagacgcccaccaccaccactggacaatggtggagtgcagcggaactcagctctgg
gcctccggccgccccttcatcatccacggcttcaacacctactggctcatgtcattcgcc
gctgaccaagccacgcgcccgcgggtcaccgccgccatcgccgaggccgccgaggccggc
ctcaacgtctgccgcacctgggcctttagtgacggcggttaccgcgcgctgcagaccgta
cccttccactacgacgaggatgtcttccaggctttagactttgtggtcagcgaggcaaaa
aggcataacatgaggttgatactgtcactttgtaacaactgggaagattatggaggcaag
gcacagtatgtgagatggggaaaagaggctggtctagatcttacttctgaagatgacttc
ttctctgacccaacaattaagagctactacaaagcttttgttgaggctgttgtgacaaga
ataaacacggttacgaatgaaacctacaaagatgatcctactattcttgcctgggagcta
attaatgagccacgctgcccttcagatccatctggagatactttgcaggcatggatagaa
gagatggcatcttatgtgaagagtatagaccctgtgcatctcttggagattggtattgaa
ggcttttatggcctatccactccagaacttctgcctgttaacccagatgagtattcaggg
catgctggaacagacttcatcaggaaccatcaagcacctggaattgacctggcgtctatt
catgtttactctgacacttggctgcctcactcgataaaggaaaatcaccttcaatttgtg
gataaatggatgcaacaacatattcatgatgcagccaatttacttgggatgccaattgtg
gttggggagtttggggtatcagttaaggacgggaagtttggtaatgaattccgtgaagat
ttcatgaagacagtttacagaattttcttgagttcttggaaggaaggagtgattggagga
ggttgccttctttggcagcttttccctgaaggagcagagcacatggatgatggttatgca
gttatttttgcaaaatcaccatccacattaagcttacttgcaaatcacttaaggtgtctg
gaatgttga

DBGET integrated database retrieval system