KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276049
Entry
107276049         CDS       T01015                                 
Name
(RefSeq) protein SYM1-like
  KO
K13347  peroxisomal membrane protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107276049
SSDB
Motif
Pfam: Mpv17_PMP22 K_channel_TID
Other DBs
NCBI-GeneID: 107276049
NCBI-ProteinID: XP_015618782
UniProt: B9GBN8 A0A8J8YFC9
LinkDB
Position
12:complement(1336170..1339526)
AA seq 268 aa
MAMASTLPLLLVHRSTPPTPRPTAPPLLHSRRLALPPRPASLPATTAVVHPRKGVRLSKL
HAASCCDSASAAGVAAGGGGGGGGAKGEMDWRLLLAWYLLALDKHPITTKAVTSAVLTLT
GDLICQLAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVMINGASGAIARLLL
DQFIFSPIFIGVFMSLLVTLEGKPSLVVPKLKQEWLSSVIANWQLWIPFQFLNFYFVPQK
FQVLAANFVALAWNVILSFKAHKEVTVK
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcgatggcctccaccctcccgctcctcctcgtgcaccgctccacccctccgactccg
aggcccaccgcgccgccgctcctccactcccgccgcctcgccctccctccccgccccgcc
tcgctcccggcgacaaccgccgtcgtccacccgcgcaagggcgtccgcctctcgaagctc
catgccgcctcctgctgcgattccgcctccgccgccggagtcgccgccggaggaggaggt
ggtggtggtggagcaaaaggagaaatggattggcgtctcctgctggcttggtacctgctg
gctcttgataagcatcccatcaccactaaggctgttacctctgccgtcctaaccctgacc
ggagacctcatctgccagctcgcaattgataaagtgccaaagctagatttgaagagaacg
tttgtattcacatttttgggactcgtcctggtggggccaacattgcatgtctggtacttg
tacttgagtaaattagtgatgatcaatggtgcgtcaggtgcaattgctcgcctcttactt
gatcagttcattttctctcccattttcattggagtgtttatgagtttactcgtcaccttg
gagggaaagccttctcttgtagttccaaagctcaagcaggagtggttatcatcagtgatt
gcaaattggcaattgtggataccttttcagttcttgaatttttactttgtcccacaaaaa
tttcaggttcttgctgctaattttgtagcccttgcgtggaacgtgattctatcatttaaa
gctcacaaagaagttactgtgaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328779
Entry
4328779           CDS       T01015                                 
Name
(RefSeq) peroxisomal membrane protein PMP22
  KO
K13347  peroxisomal membrane protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4328779
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 4328779
NCBI-ProteinID: XP_015623632
UniProt: A0A0P0VGP4 Q6H6J7
LinkDB
Position
2:complement(7066389..7069489)
AA seq 205 aa
MAAAAVAAGRGGVRGRGEGEEGSLARRAWRQYLRQLQLHPLRTKMITAGCLAGVSDSVAQ
KLSGYQRIEKRRLLLKMLFGFAYGGPFGHFLHKVLDYIFKGKKDTKTIAKKVLLEQITSS
PWNNLLFLFYYGYVVERRPFKEVKTRVKKQYPSVQLSAWMFWPIVGWINHMYMPLQFRVI
FHSFVACCWGIFLNLRARAMSLKQS
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcagcagcagcagtagcagcagggagaggaggggttaggggaagaggagagggggag
gaggggtcgctggctcggcgggcgtggcggcagtacctgcgccagctccagctccaccct
ctccggaccaagatgatcacggcggggtgcctcgccggcgtcagcgactccgtggcgcag
aagctctccggctaccagaggatcgagaagcgccgcctcctgctcaagatgctctttggg
tttgcttatggtggcccttttggccatttcctccataaagtgttagattatatcttcaaa
gggaagaaggataccaaaactatagccaagaaggtgttactggagcagatcacttcttct
ccctggaataatctgctcttcttgttctattatggatatgttgttgagaggaggcctttt
aaggaggtgaagaccagggttaagaaacaatatccctcggtgcaattgtctgcttggatg
ttttggccaatagttggttggataaatcatatgtacatgccgttgcagttccgggtgatt
ttccacagctttgttgcatgttgctgggggatatttcttaaccttcgtgcaagggccatg
tctttgaagcagtcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346360
Entry
4346360           CDS       T01015                                 
Name
(RefSeq) peroxisomal membrane protein PMP22
  KO
K13347  peroxisomal membrane protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4346360
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 4346360
NCBI-ProteinID: XP_015648558
UniProt: B9FYL4 Q6Z1N7
LinkDB
Position
8:28388158..28391058
AA seq 187 aa
MSDVVAMAGQAYMRQLQAHPLRTKAITSGVLAGCSDAIAQKISGVPNLQRRRLLLIMLYG
FAYAGPFGHFLHKLMDRFFKGKKGKETTAKKVLVEQLTASPWNNMMFMMYYGLVVEGRPF
SQVKSKLKKDYASVQLTAWKFWPIVSWINYEYMPLQLRVLFHSFVASCWAVFLNLKAARS
IATSKKA
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtctgatgtggtggctatggcggggcaggcgtacatgcggcagctccaagcccacccg
ctgcgcaccaaggccatcacctccggcgttctcgccggctgcagcgacgccatcgcccag
aagatctccggcgtccccaacctccagcgcaggaggctcctcctcatcatgctctatgga
tttgcttatgcgggaccgtttggccattttctccacaagctgatggacaggtttttcaag
ggaaagaaaggaaaagaaactacagccaagaaggtcttagtggagcaactaactgcgtca
ccatggaacaatatgatgtttatgatgtactatggtctggtggttgaagggagacctttt
agtcaagtgaagagcaagctcaagaaagactacgcatctgtccagttgacagcttggaag
ttctggccaattgttagttggataaactatgaatacatgccgctccagctccgagttctt
ttccacagctttgttgcatcgtgctgggcagtatttctgaacctgaaagcagcaaggtcc
attgccactagtaagaaggcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349678
Entry
4349678           CDS       T01015                                 
Name
(RefSeq) protein SYM1
  KO
K13347  peroxisomal membrane protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4349678
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 4349678
NCBI-ProteinID: XP_015615735
UniProt: A0A0P0XYD9
LinkDB
Position
11:complement(1429176..1432762)
AA seq 268 aa
MAMASTLPLLLVHRSTPPTPRPTAPPLLHSRRLTLPSRLASLPATIAVVHPRKGVRLSKL
HAASCCDSASAAGVTTGGGAGGGGAKGAMDWRLLLAWYLLALDKHPITTKAVTSAVLTLT
GDLICQLAIDKVPKLDLKRTFVFTFLGLVLVGPTLHVWYLYLSKLVTINGASGAIARLLL
DQFIFSPIFIGVFMSLLVTLEGKPSLVVPKLKQEWLSSVIANWQLWIPFQFLNFYFVPQK
FQVLAANFVALAWNVILSFKAHKEVTVK
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcgatggcctccaccctcccgctcctcctcgtgcaccgctccacccctccgactccg
aggcctaccgcgccgccgctcctccactcccgccgcctcacccttccttcccgcctcgcc
tcgctccccgcgacaatcgcagtcgtccacccgcgcaagggcgtccgcctctcgaagctc
cacgccgcctcctgctgcgattccgcctccgccgccggagtcaccaccggaggaggagct
ggtggtggtggagcaaaaggagcaatggattggcgtctcctgttagcctggtacctgctg
gctcttgataagcatcccatcaccactaaggctgttacctctgccgtcctaaccctgacc
ggagacctcatctgccagcttgcaattgataaagtgccaaagctagatttgaagagaacg
tttgtattcacatttttgggacttgtcctggtggggccaacattgcatgtctggtacttg
tacttgagtaaattagtgacgatcaatggtgcatcaggtgcaattgctcgcctcttactt
gatcagttcattttctctcccattttcattggagtgtttatgagtttactcgtcaccttg
gagggaaagccttctcttgtagttccaaagctcaagcaggagtggttatcatcagtgatt
gcgaattggcaattgtggataccctttcagttcttgaatttttactttgtcccacaaaaa
tttcaggttcttgctgctaattttgtagcccttgcgtggaacgtgattctatcatttaaa
gctcacaaagaagttactgtgaaatag

DBGET integrated database retrieval system