KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276062
Entry
107276062         CDS       T01015                                 
Name
(RefSeq) probable sarcosine oxidase
  KO
K00306  sarcosine oxidase / L-pipecolate oxidase [EC:1.5.3.1 1.5.3.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00310  Lysine degradation
osa01100  Metabolic pathways
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107276062
   00310 Lysine degradation
    107276062
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107276062
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase (formaldehyde-forming)
     107276062
    1.5.3.7  L-pipecolate oxidase
     107276062
SSDB
Motif
Pfam: DAO HI0933_like FAD_oxidored NAD_binding_8 GIDA Amino_oxidase Pyr_redox_2 FAD_binding_2 Pyr_redox_3 Thi4 3HCDH_N
Other DBs
NCBI-GeneID: 107276062
NCBI-ProteinID: XP_015611899
UniProt: A0A0P0XPG5
LinkDB
Position
9:complement(19272327..19275816)
AA seq 416 aa
MAAAANNGGEGGDGFDVIVVGAGIMGSCAAYAASTRGGARVLLLERFDLLHHRGSSHGES
RTIRATYPQAHYPPMVRLAARLWDDAQRDAGYRVLTPTPHLDMGPRADPALRASIVNGAA
TEVASDAAAPWPWSGVFRLPEGWTAATSEIGGVMKATKAVAMFQSLAAKNGAVVRDRTEV
VGIAKQGDGSIVVKTSSGEEFHGAKCIITVGAWASKLVRSVAGVDLPVQPLHTLICYWRA
RPGREHELTPESGFPTFASYGDPYIYSTPSMEFPGLIKVAAHGGPPCDPDRRDWLAGAGA
GLVEPVARWIDEVMPGHVDTAGGPVIRQPCMYSMTPDEDFIIDFVGGELGKDVVVGAGFS
GHGFKMGPAVGRILAEMALDGEARTAAEAGVELRHFRIGRFEDNPEGNLAENKVKN
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgaacaacggcggcgagggcggcgacggcttcgacgtgatcgtggtg
ggggccgggatcatgggcagctgcgcggcgtacgcggcgtcgacccgcggcggcgcgcgc
gtgctgctcctggagcggttcgacctgctccaccaccggggctcgtcgcacggcgagtcc
cgcaccatccgcgccacgtacccgcaggcgcactacccgcccatggtccgcctcgccgcg
cgcctctgggacgacgcccagcgcgacgccggctaccgcgtgctcaccccgacgccgcac
ctcgacatgggcccccgcgccgaccccgcgctccgcgcctccatcgtgaacggcgccgcc
accgaggtcgcctccgacgcggcggcgccgtggccgtggtccggggtgttcaggctgccc
gaggggtggacggcggcgacgagcgagatcggcggcgtgatgaaggcgaccaaggcggtg
gccatgttccagtcgctcgccgccaagaacggcgccgtcgtgcgggacaggacggaggtt
gtcggcatcgccaagcaaggagacggatcgatcgtggtgaagacatcgagcggcgaggag
ttccatggcgccaagtgcatcatcacggtgggcgcctgggccagcaagctggtgaggtcg
gtcgccggcgtcgacctgccggtgcagccgctgcacacgctcatctgctactggcgggcg
aggcccggccgcgagcacgagctcacgccggagtccggcttcccgacgttcgccagctac
ggcgacccgtacatctacagcacgccgtcgatggagttcccggggctgatcaaggtggcc
gcccacggcggcccgccgtgcgacccggaccgccgggactggctcgccggcgccggcgcc
ggcctggtcgagccggtggcgcggtggatcgacgaggtcatgccgggccacgtcgacacc
gccggcgggccggtcatccggcagccgtgcatgtactccatgacccccgacgaggacttc
atcatcgacttcgtcggcggggagctcgggaaggacgtcgtggtcggcgccgggttctcc
ggccatggcttcaagatggggcccgccgtcgggaggatcctcgccgagatggccttggac
ggcgaggccaggacggcggcggaggccggagtagagctccggcatttcaggattgggcgt
ttcgaggacaatccagagggaaatctcgcggaaaataaggtcaaaaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327296
Entry
4327296           CDS       T01015                                 
Name
(RefSeq) probable sarcosine oxidase
  KO
K00306  sarcosine oxidase / L-pipecolate oxidase [EC:1.5.3.1 1.5.3.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00310  Lysine degradation
osa01100  Metabolic pathways
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4327296
   00310 Lysine degradation
    4327296
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4327296
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase (formaldehyde-forming)
     4327296
    1.5.3.7  L-pipecolate oxidase
     4327296
SSDB
Motif
Pfam: DAO FAD_oxidored GIDA NAD_binding_8 HI0933_like FAD_binding_3 Amino_oxidase 3HCDH_N FAD_binding_2 Pyr_redox_2
Other DBs
NCBI-GeneID: 4327296
NCBI-ProteinID: XP_015644759
UniProt: Q8RZT1
LinkDB
Position
1:complement(11944157..11945636)
AA seq 414 aa
MAAAAAAASDDAAAAGGRFDFDVIVVGAGIMGSCAAHAAASRGARALLLERFDLLHHLGS
SHGASRTIRDAYAKAHYPPMVRLARRLWADAEAESGYRVLTPAPQLTVGPPGDASLLAAV
GNSGARRVDEDDLAGRWGGAFRGVPDGWVAAVSELGGGVLNATKAVAMFQALAVKGGAVV
RDNAEVVGVVKKDGEAGVFVRTSGGEEFHGAKCVVTVGAWTSKLVKSVAGVDLPIQPLHA
LVLYWKVKPGRERELAAEAGFPTFSSHGDPHVYGTPSLELPGLIKINYDGGPPCDPDGRD
WAGGGGDAASRVARWIEEFMPDHVEAAGGPVVRQPCMYSMTPDKDFVIDFLGGEFGDDVV
VGAGFSGHGFKMGPAVGRILAEMAMDGEARTAAEAGVELRHFRISRFEGNAMGN
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggccgcagccgcagccgcagcgtccgatgatgccgccgccgccggcggccggttcgac
ttcgacgtcatcgtggtgggcgcgggcatcatgggcagctgcgcggcgcacgcggcggcg
tcccgcggcgcgcgcgccctgctcctggagcgcttcgacctgctccaccacctcggctcc
tcgcacggcgcgtcgcgcaccatccgcgacgcctacgccaaggcgcactacccgcccatg
gtgcgcctcgcccgccgcctctgggccgacgccgaggccgagtccggctaccgcgtgctc
accccggcgccgcagctcaccgtgggcccgcccggcgatgcctcgctgctcgccgccgtc
gggaactccggcgcgcgccgggtggacgaggacgacctcgccgggaggtggggcggcgcg
ttccgcggcgtcccggacgggtgggtggctgccgtcagcgagctcggcggcggcgtgctg
aacgcgaccaaggcggtggccatgttccaggcgctcgccgtcaaggggggcgccgtcgtc
agggacaacgcggaggtcgtcggcgtcgtcaagaaggacggtgaggccggagtcttcgtg
aggacgagcggcggcgaggagttccacggcgccaagtgcgtcgtgacggtgggcgcctgg
acgagcaagctggtcaagtccgtcgccggcgtggacctccccatccagccgctgcacgcg
ctcgtcctgtactggaaggtcaagcccggccgcgagcgcgagctcgcggcggaggccggc
ttcccgacgttctccagccacggcgacccgcacgtgtacggcacgccgtcgctggagctc
ccgggcctgatcaagatcaactacgacggcggcccgccgtgcgacccggacggccgggac
tgggccggcggcggcggcgacgcggcctcccgcgtcgcccggtggatcgaggagttcatg
ccggaccacgtcgaggccgccggcgggccggtcgtccggcagccgtgcatgtactccatg
acgccggacaaggacttcgtgatcgacttcctcggcggcgagttcggcgacgacgtggtg
gtcggggccgggttctccggccacgggttcaagatggggccggcggtggggaggatcttg
gccgagatggccatggacggggaggcgaggacggcggcggaggccggggtggagctccgg
cacttcaggatcagccggtttgagggcaacgccatgggaaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352447
Entry
4352447           CDS       T01015                                 
Name
(RefSeq) probable sarcosine oxidase
  KO
K00306  sarcosine oxidase / L-pipecolate oxidase [EC:1.5.3.1 1.5.3.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00310  Lysine degradation
osa01100  Metabolic pathways
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4352447
   00310 Lysine degradation
    4352447
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4352447
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase (formaldehyde-forming)
     4352447
    1.5.3.7  L-pipecolate oxidase
     4352447
SSDB
Motif
Pfam: DAO HI0933_like Amino_oxidase FAD_oxidored NAD_binding_8 GIDA AAA_31 Pyr_redox_2
Other DBs
NCBI-GeneID: 4352447
NCBI-ProteinID: XP_015618969
UniProt: Q2QP28
LinkDB
Position
12:21869718..21871570
AA seq 420 aa
MAAAAAATNGGFDVIVVGGGIMGSCAAYAAASSSASRCGGARVLLLERFDLLHHRGSSHG
ESRGIRATYPQARYPPMVRLAARLWGNAEAEAGYRVLTPTPHLDMGPRADPALRAAIQNG
GAAEVVGASDDSAASWLWSAVFRLPEGWTAASSELGGVIKATKAVAMFQSLAAKNGAVLR
DRTEVIDIAKQGDGSILVKTSSGEEFHGAKCIITVGAWASKLVKSVAGVDLPVQPLHTLI
CYWKARPGREHELTPESGFPTFASYGDTCIYSTPSMEFPGLIKVCAHGGAPCDPDRRDWC
AGGDALADPVARWIDELMPGHVDTAGGPVIRQSCMYSMTPDEDFIIDFVGGEFGKDVVVG
AGFSGHGFKMGPAVGRILAEMAMDGEAKTAAEAGVELGYFRIGRFEGNPEGNRAENKVKI
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgaccaacggcggcttcgacgtgatcgtggtgggcggcggc
atcatgggcagctgcgcggcgtacgccgcggcgtcgtcgtcggcgtcccgctgcggcggc
gcgcgcgtgctgctcctggagaggttcgacctgctccaccaccgcggctcgtcgcacggc
gagtcccgcggcatccgcgccacgtacccgcaggcgcggtacccgcccatggtgcgcctc
gccgcgcggctctggggcaacgccgaggccgaggcgggctaccgcgtgctcaccccgacg
ccgcacctcgacatgggcccgcgcgccgacccggccctccgcgccgccatccagaacggc
ggcgccgccgaggtcgtcggcgcctcggacgattcggcggcgtcgtggctgtggtccgcg
gtgttccgcctgcccgaggggtggacggcggcgagcagcgagctcggcggcgtcatcaag
gccaccaaggcggttgccatgttccagtcgctcgccgccaagaacggcgccgtgctcagg
gacaggacggaggtgatcgacatcgccaagcaaggagatggatcgatcttggtgaagacg
tcgagcggggaggagttccacggcgccaagtgcatcatcacagtgggcgcgtgggcgagc
aagcttgtcaagtcggtcgccggcgtcgacctgccagtgcagccgctgcacacgctcatc
tgctactggaaggcccgccccggccgcgagcatgagctcacgccggagtccggcttcccg
acgttcgccagctacggtgacacctgcatctactccacgccgtccatggagttcccaggc
ctgatcaaggtgtgcgcgcacggcggtgcgccgtgcgacccggataggcgggactggtgc
gctggcggcgacgccctggcggacccggtggcgcggtggatcgacgagctcatgcccggc
cacgtcgacaccgccggtgggccggtcatccggcagtcgtgcatgtactccatgacccct
gatgaggatttcatcatcgacttcgttggtggggagtttggaaaggatgtggttgtcggc
gccgggttctccggccatggcttcaagatgggacctgcagtcgggaggatcctcgccgag
atggccatggacggcgaggccaagacggcggcggaggccggagtggagcttgggtatttc
aggattggacgtttcgagggtaacccggagggaaatcgtgctgaaaataaggtgaaaatt
tga

DBGET integrated database retrieval system