KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276068
Entry
107276068         CDS       T01015                                 
Name
(RefSeq) adenylate kinase 4
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107276068
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    107276068
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107276068
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     107276068
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107276068
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 Zeta_toxin RuvB_N
Other DBs
NCBI-GeneID: 107276068
NCBI-ProteinID: XP_015615393
UniProt: Q08480
LinkDB
Position
11:12034634..12039458
AA seq 243 aa
MAAAANLEDVPSMDLMNELLRRMKCSSKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLA
TGDMLRAAVAAKTPLGVKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTV
VQAQKLDEMLEKKGTKVDKVLNFAIDDSILEERITGRWIHPSSGRSYHTKFAPPKVPGVD
DVTGEPLIQRKDDTAEVLKSRLEAFHKQTEPVIDYYSKKALVANLHAEKPPKEVTAEVQK
VLS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgaacctggaggacgtcccgtccatggatctgatgaacgagctgcta
cgccgcatgaagtgcagctccaagcccgacaagcgcctcatcctcgtaggtccacctggc
tctggaaagggaacacaatcgcccattattaaggatgagtactgcttatgccatttagct
acaggtgatatgttgagagctgctgttgctgctaagactcctttaggagtcaaggcgaaa
gaagcaatggacaagggagagcttgtttctgatgacttggttgttggaattattgatgaa
gccatgaagaaaccttcatgtcaaaagggtttcattcttgatgggttcccacggacagtt
gttcaggcacagaagcttgatgaaatgctggaaaagaaaggtacaaaggtcgataaggtt
cttaactttgccattgatgattcaattttggaagaaagaattactggccggtggatccat
ccctccagtggcaggagttatcacactaagtttgcacctccaaaggttcctggagttgat
gatgtcactggagaaccactaattcaaaggaaagacgacacagctgaggttttgaagtct
agacttgaagccttccacaaacaaactgaaccagtgattgactactactccaagaaggcc
ttggtggccaatcttcatgccgagaagccaccgaaagaagtaactgctgaagtccagaaa
gttctttcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331502
Entry
4331502           CDS       T01015                                 
Name
(RefSeq) probable adenylate kinase 1, chloroplastic isoform X1
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4331502
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4331502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4331502
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     4331502
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4331502
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 ADK_lid AAA_28
Other DBs
NCBI-GeneID: 4331502
NCBI-ProteinID: XP_015627822
UniProt: Q10S93
LinkDB
Position
3:1716442..1719681
AA seq 293 aa
MAAVQRLLRASASGGAAAAAAAARRRMSTAVAPEQTPAAAAFPFAAAAGRARQRVAEERN
VQWVFLGCPGVGKGTYASRLSRLLGVPHIATGDLVRDELASSGPLSVQLAEIVNQGKLVS
DEIIINLLSKRLKKGEEQGESGFILDGFPRTVKQAEILDGVTDIDMVVNLKLREDVLVEK
CLGRRICGQCGKNFNLACIDVKGENGLPPIYMAPLLPPNNCMSKLITRADDTEEVVRNRL
QIYNDMSQPVEGFYRQQGKLLEFDLPGGIPESWPKLLHVLNLEDQEEMKLATA
NT seq 882 nt   +upstreamnt  +downstreamnt
atggcggccgtgcagcgactcctgcgggcgtccgcctccggtggcgcggcggcggcggcg
gcggcggcgaggaggcgcatgtccacggcggtggcgccggagcagacgcctgcggccgcg
gcgttcccgttcgcggcggcggcggggagggcgaggcagcgggtggcggaggagaggaac
gtgcagtgggtgttcctcgggtgccccggcgtgggcaaggggacttatgccagccgcctc
tcccgcctcctcggcgtgccccacatcgccaccggggatctcgtccgcgacgagctcgct
tcctccggccccctatctgtgcagcttgctgaaattgttaatcaggggaaattagtttct
gatgaaattatcatcaatctgttatctaaacgtcttaagaaaggagaagagcagggggaa
tcgggatttattctggatggttttccacgtactgtaaaacaagcggaaattcttgatgga
gttactgacattgatatggtggtcaatctaaagttgagagaggatgtcctagttgagaag
tgccttggcagacgtatttgtggccaatgtggaaagaacttcaatttggcctgcattgat
gtgaagggtgaaaatgggctgccaccaatctacatggcaccactattgcccccaaataac
tgtatgtcaaagcttatcaccagagctgatgataccgaagaggtcgtgagaaatcgtctt
cagatatataatgacatgagccaacctgttgagggtttctaccggcaacaggggaagctt
ttagaatttgatttgcctggaggaatccctgagtcttggccaaagctgctccatgttcta
aatctcgaggaccaagaagagatgaagctggccactgcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337358
Entry
4337358           CDS       T01015                                 
Name
(RefSeq) probable adenylate kinase 6, chloroplastic
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4337358
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4337358
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337358
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     4337358
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4337358
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 ADK_lid AAA_33 AAA_28
Other DBs
NCBI-GeneID: 4337358
NCBI-ProteinID: XP_015633564
UniProt: Q7XR47
LinkDB
Position
4:complement(34236405..34238977)
AA seq 285 aa
MAAISRAIRACAAAGSRRSMASSAKEVAAAGARAAAAVARRGREREREEDGRRVQWVFLG
CPGVGKGTYASRLSQMLRVPHIATGDLVRDALASPGPFSEQLAEIVNNGKLVSDEIIINL
LSKRLEEGAEKGELGFILDGFPRTIRQAEILEGVTDIDLVINLKLREEALLAKCLGRRMC
SQCGGNFNVASIDMEGENGGPRMYMPPLLPPPQCESKLITRPDDTEEVVKERLRVYHDLC
EPVEDFYRARGKLLEFNLPGGIPESWPKLLQALNLDPGNERSAAA
NT seq 858 nt   +upstreamnt  +downstreamnt
atggcggcgatctcgcgcgcgatccgggcgtgcgccgccgcggggtcccggcggagcatg
gcgtcgtcggcgaaggaggtggcggcggccggggcgcgggcggcggcggcggtggcgcgg
cgcgggcgggagcgggagcgggaggaggacgggaggcgcgtgcagtgggtgttcctgggc
tgccccggggtggggaagggcacctacgccagccgcctctcgcagatgctccgcgtgccc
cacatcgccaccggcgatctcgtccgcgacgccctcgcctccccgggccccttctccgag
cagcttgcggagattgtgaataatggaaagctagtgtcggatgagatcataataaatctt
ctgtcaaagcggcttgaagagggagcagaaaagggtgagctgggcttcatccttgatggt
tttccaagaaccataagacaagcggagatacttgaaggagtcacggatattgatttggtc
atcaacctcaaactccgagaagaggctctgcttgcaaaatgccttggtagaaggatgtgc
agccagtgtggtggaaattttaatgtagcgtccattgatatggagggcgaaaatggtggt
cctcgaatgtacatgcctccactactgcctcctccacagtgtgaatcaaagttgataact
aggcctgatgatactgaagaggtggtaaaggagcgattgcgtgtttatcatgatttgtgt
gagccagtggaggacttctacagagcacgtggtaaactattggagttcaatctaccagga
ggaattccagaatcatggccgaagttactgcaagcattgaatttagaccctggcaatgaa
agatctgcagcagcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344470
Entry
4344470           CDS       T01015                                 
Name
(RefSeq) probable adenylate kinase 2, chloroplastic
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4344470
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4344470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344470
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     4344470
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4344470
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 Thymidylate_kin Zeta_toxin Hydin_ADK
Other DBs
NCBI-GeneID: 4344470
NCBI-ProteinID: XP_015649892
UniProt: Q6ZC69
LinkDB
Position
8:complement(461542..464823)
AA seq 290 aa
MASSMAATATLSPPVLSAERPTVRGGLFLPPSPATSRSLRLQSARRCGISPATRKPRSLP
RAAKVVVAVKADPLKVMIAGAPASGKGTQCELIKSKYGLVHISAGDLLRAEIAAGSENGK
RAKEFMEKGQLVPDEIVVNMVKERLLQPDAQEKGWLLDGYPRSYSQAMALETLNIRPDIF
ILLDVPDELLVERVVGRRLDPVTGKIYHLKYSPPENEEIASRLTQRFDDTEEKVKLRLQT
HYQNVESLLSIYEDVIVEVKGDALVDDVFAEIDKQLTSSLDKKTEMVASA
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcctcttccatggccgccaccgccaccctctcgccgccggttttatccgccgagagg
ccgactgtccgcggcggcctcttcttgcccccttcgccggcgacctcccgctctctccgc
ctccaatccgcccgccgctgcggcatctcgccggcgaccaggaagccacgctccttgcct
cgagcagccaaggttgttgtggctgtgaaggctgatcctttgaaggtcatgatagcaggg
gctccagcatctggaaagggaacgcagtgtgagctcatcaagagcaaatatggtctggtg
cacatttctgctggagatttgctaagggcagaaattgctgcaggcagtgagaatgggaag
cgagctaaggaatttatggagaagggtcagctggttcctgatgagattgttgttaatatg
gtgaaggaacgccttctgcaaccagatgctcaggaaaagggttggttgttggatgggtac
ccaagaagctattcgcaagcgatggcgctggaaactcttaatatccgacctgacattttc
attcttttggatgttccagatgaacttcttgttgaaagggtagttgggagacggcttgat
cctgtaactgggaaaatataccatctaaagtattccccaccggagaatgaagaaatcgct
tcaaggcttacacagagatttgatgatacagaagaaaaggttaagctgaggttacagact
cattatcaaaatgtagaatccttgctatcaatttacgaagatgtgatagttgaggtaaaa
ggggatgctttggtggatgatgtgtttgctgagatcgacaagcagctgacttctagcctt
gataagaaaacagaaatggtggctagcgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344534
Entry
4344534           CDS       T01015                                 
Name
(RefSeq) probable adenylate kinase 7, mitochondrial
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4344534
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4344534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344534
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     4344534
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4344534
SSDB
Motif
Pfam: ADK AAA_17
Other DBs
NCBI-GeneID: 4344534
NCBI-ProteinID: XP_015648647
UniProt: Q6ZJ48
LinkDB
Position
8:1046922..1049983
AA seq 299 aa
MAGVLRLAGAARSPLARALAPAARRMGASAAAAMEDEAYWTEWEEEEEKARARESAPVAE
MCPTGGGGGGPQWVVMGRPGPQKHAHAARLAEVLAVPYISMGTLVRQELSPASSLYKKIA
NSVNEGKLVPEDIIFGLLTKRLEEGYNKGETGFILDGIPRTHMQAEILDEIVDIDLVLNF
KCADNCFMKRRFGGDICPHCGQLFDFSKTASSDRNPSLGSCTWPSQVQHAAVLGLEDSRM
EKMRAYAEQTKLLEDYYRKQRKLMELKTSARPGETWQGLVAALHLQHLDASPTPHKLTM
NT seq 900 nt   +upstreamnt  +downstreamnt
atggccggcgtcctgcggctcgccggcgccgcgcggtccccactggcccgcgcgctggcc
cccgccgcacggaggatgggggcgtcggcggcggcggctatggaggacgaggcgtactgg
accgagtgggaggaggaggaggagaaggcgagggcgcgggagtccgcgcccgtcgcggag
atgtgccccaccggcggcggcggcggtggcccgcagtgggtggtgatggggaggcccggg
ccgcagaagcacgcccacgccgcccgcctcgccgaggtgctcgccgtgccgtacatctcc
atggggacgctcgtcaggcaggagctcagcccggcgtcctctctctacaagaagattgca
aattcggtgaatgaagggaaacttgtgcccgaggacattatatttggattgctgacgaag
cgtcttgaggagggatacaataagggtgaaactggattcatccttgatgggatcccacgc
actcatatgcaggcggagattctcgatgagattgtggatatcgacttggttctgaacttc
aaatgtgctgataactgttttatgaagaggcggtttggtggtgacatctgcccccactgt
ggacagctttttgattttagcaaaactgcgtcttcagaccgtaatccgagccttgggagc
tgtacatggccttctcaggtgcaacatgctgcagttttaggtctggaggactcgagaatg
gagaagatgcgtgcttatgctgaacagaccaagctactggaagactactacaggaaacag
agaaaacttatggaattgaagacatcagctcgccctggagaaacatggcagggacttgtc
gctgccctacatctccagcatctggatgcatccccgacgccgcacaaactcactatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345177
Entry
4345177           CDS       T01015                                 
Name
(RefSeq) probable adenylate kinase 5, chloroplastic
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4345177
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4345177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4345177
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     4345177
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4345177
SSDB
Motif
Pfam: ADK DUF1995 AAA_17 AAA_18 Thymidylate_kin Zeta_toxin Rotamase_3 AAA_33 Cytidylate_kin TrcR
Other DBs
NCBI-GeneID: 4345177
NCBI-ProteinID: XP_015648092
UniProt: Q0J6P7
LinkDB
Position
8:complement(11442524..11453900)
AA seq 608 aa
MAASSSSSSPAAASAPFAAPGPHRRPGLALRPSPPTPPSSSLSCCRASPAAAAVSSVSAT
AAPNRGPRGMGLRCRASEGAAAAARKEAPLKVMISGAPASGKGTQCRMIVEKYGLVHIST
GDLLRAEVSSGTEIGKKAKEYMDNGMLVPDQVVTDMVVSRLSQPDVRERGWLLDGYPRSY
AQAQSLESMKIRPDIFIVLEVPDDILIDRCVGRRLDPETGKIYHIKNFPPENDEVSARLV
TRSDDTFEKVKSRLDTYKQNSEAVIPTYSDLLNQIDGNRQVEVVFNEIDSLLQKICENAS
FNMLAKTNGKPQDSKDTTASKNEFRGIPTRLNNIPHSREIRKYFYNDVLVATRHAVEDKK
TRLQIDINIPELNPEMDVYRIGTLMELVRELSLSFADDGKRVKVCVQGSMGQGAFAGIPL
QLAGTRKILEIMDWGEYGAKGTFINFGAVGASEVDKEDDMFILIAPQNAVGNCIIDDMKA
MTDAAGDRPVILVNPRLKDMPGSSGVMQTMGRDMRLKYAASFETCYSFRLLFYAGSFYPI
MGALRMAYPNKYEIYRRVDEPNGQERYVLLEEFVEKPTPDEITNAFRPRKNENEKSASGF
WGFLSGIL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcggcctcctcctcctcctcgtcgccggccgcggcctccgctcccttcgccgcgccg
gggccccaccgccgccccggactcgcgctgcgcccctcgccgccgacgccgccttcctcc
tccttgtcctgctgccgcgcttcccccgccgccgcggccgtctcgtccgtctccgccacc
gccgccccgaatcgcgggcccagggggatgggtcttcgttgccgggcatcggagggagcg
gcggcggcggcgcggaaggaggccccgctcaaggtgatgatctcgggtgcacccgcgtct
gggaagggaacgcaatgccgcatgatcgtcgagaagtatggtttggttcacatatcaact
ggggatcttctgcgggccgaagtatcttctggcaccgaaataggcaagaaagcaaaagaa
tatatggacaatggtatgctagtcccggatcaagttgtgacagatatggtggtatcacga
ctatcacaacctgatgttagagaaagaggatggcttctcgatggttacccgagaagttat
gcccaggcacaaagtctcgaaagtatgaaaatacgaccagatatattcattgtgctggaa
gttcctgatgatattctaatcgacagatgtgttggaagaaggttggatcctgagactggc
aaaatttaccacataaagaacttccctccggagaatgatgaagtttctgctcgtcttgtt
acacgctctgatgatacatttgagaaggttaaatcacgtcttgatacttacaaacaaaat
tctgaagctgttatcccaacatactcagatttgctcaaccagattgatggaaatcgacaa
gtggaagtcgtttttaatgaaatagattcactgttacagaagatctgtgagaatgcttca
tttaacatgttggccaaaacaaatggaaaaccacaagattctaaggatacaacagcctca
aaaaatgagtttcgtgggattccaacaagattaaataacattccacattccagggaaatc
aggaaatacttttacaatgatgtactagtagccaccagacatgctgttgaagacaaaaaa
actcggttgcagatagatatcaacattcctgaacttaaccctgaaatggatgtttatcgc
ataggaaccctcatggaacttgtgcgagagctttctctttcctttgctgatgatggaaag
cgtgtgaaggtttgcgttcaaggctccatgggacaaggtgcatttgctggtattccactt
cagcttgctggaaccagaaaaattttggaaatcatggactggggtgaatatggggccaag
ggtaccttcattaattttggagcagtaggtgctagtgaggttgataaagaagatgacatg
ttcatcctcattgctccccaaaatgctgttggaaactgtataattgatgacatgaaagca
atgactgatgctgctggtgacagacctgtgattcttgtaaatcctcgcttaaaggatatg
cctggatcaagtggtgtaatgcaaacaatgggaagagacatgaggctaaaatatgctgca
tcttttgagacttgttattccttccggcttctcttctatgctggctcattttatcctatt
atgggagctctaaggatggcttatcctaataaatatgagatttatcgaagggttgatgaa
cccaatggacaagaacgatatgttctcttagaggaatttgtggagaagccaactcctgat
gaaatcaccaatgcattcagaccacgtaaaaacgaaaatgaaaagtcagcgtctggattc
tggggttttttgagtggtatattatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350358
Entry
4350358           CDS       T01015                                 
Name
(RefSeq) adenylate kinase 4
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4350358
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4350358
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4350358
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     4350358
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4350358
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 Zeta_toxin RuvB_N
Other DBs
NCBI-GeneID: 4350358
NCBI-ProteinID: XP_015615329
UniProt: Q08480
LinkDB
Position
11:12136944..12141865
AA seq 243 aa
MAAAANLEDVPSMDLMNELLRRMKCSSKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLA
TGDMLRAAVAAKTPLGVKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTV
VQAQKLDEMLEKKGTKVDKVLNFAIDDSILEERITGRWIHPSSGRSYHTKFAPPKVPGVD
DVTGEPLIQRKDDTAEVLKSRLEAFHKQTEPVIDYYSKKALVANLHAEKPPKEVTAEVQK
VLS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgaacctggaggacgtcccgtccatggatctgatgaacgagctgcta
cgccgcatgaagtgcagctccaagcccgacaagcgcctcatcctcgtaggtccacctggc
tctggaaagggaacacaatcgcccattattaaggatgagtactgcttatgccatttagct
acaggtgatatgttgagagctgctgttgctgctaagactcctttaggagtcaaggcgaaa
gaagcaatggacaagggagagcttgtttctgatgacttggttgttggaattattgatgaa
gccatgaagaaaccttcatgtcaaaagggtttcattcttgatgggttcccacggacagtt
gttcaggcacagaagcttgatgaaatgctggaaaagaaaggtacaaaggtcgataaggtt
cttaactttgccattgatgattcaattttggaagaaagaattactggccggtggatccat
ccctccagtggcaggagttatcacactaagtttgcacctccaaaggttcctggagttgat
gatgtcactggagaaccactaattcaaaggaaagacgacacagctgaggttttgaagtct
agacttgaagccttccacaaacaaactgaaccagtgattgactactactccaagaaggcc
ttggtggccaatcttcatgccgagaagccaccgaaagaagtaactgctgaagtccagaaa
gttctttcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351850
Entry
4351850           CDS       T01015                                 
Name
(RefSeq) adenylate kinase 3
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4351850
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4351850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351850
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     4351850
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4351850
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 RuvB_N Zeta_toxin DAP3 AAA ABC_tran Rad17 AAA_18
Other DBs
NCBI-GeneID: 4351850
NCBI-ProteinID: XP_015618268
UniProt: Q08479
LinkDB
Position
12:7476419..7480286
AA seq 241 aa
MAANLEDVPSMELMTELLRRMKCSSKPDKRVILVGPPGCGKGTQSPLIKDEFCLCHLATG
DMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKTSCQKGFILDGFPRTVVQ
AQKLDEMLAKQGTKIDKVLNFAIDDAILEERITGRWIHPSSGRSYHTKFAPPKTPGLDDV
TGEPLIQRKDDTAAVLKSRLEAFHVQTKPVIDYYTKKGIVANLHAEKPPKEVTVEVQKAL
S
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcggcgaacctggaggacgtgccgtcgatggagctgatgacggagctgctccgccgc
atgaagtgcagctccaagcccgacaagcgcgtcatcctcgtcggtccacctggctgcgga
aagggaacacagtcaccgctgattaaggatgaattttgcttgtgccatttagccactggt
gatatgttgagggctgcagtggctgctaaaactccacttgggattaaggctaaagaagct
atggacaagggagagcttgtttctgatgacttggttgttgggattattgatgaagccatg
aagaaaacttcatgccagaaaggttttatccttgatggtttccctagaactgttgttcaa
gcacagaagcttgatgaaatgttggccaaacaaggtactaagattgacaaggttctaaat
tttgcaattgatgatgcaatactggaagaacgaattaccggtcgttggatccacccatca
agtggtagatcttatcatacaaaatttgctcctcctaagactcctggacttgatgatgtt
actggagaacccttaattcaaaggaaagatgacacagctgcagtattgaagtcaaggctt
gaagccttccacgtacaaactaagcctgtgattgactactacaccaagaagggcatagtc
gcaaatctgcatgccgaaaaaccaccaaaggaagtgactgttgaggtccagaaagcccta
tcataa

DBGET integrated database retrieval system