KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276095
Entry
107276095         CDS       T01015                                 
Name
(RefSeq) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 isoform X1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107276095
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     107276095
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     107276095
SSDB
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 DMSP_lyase
Other DBs
NCBI-GeneID: 107276095
NCBI-ProteinID: XP_015635078
LinkDB
Position
4:16441846..16446460
AA seq 283 aa
MMQAKKPRSPLMMLIAKKPLLLLLLLLVLLVLEPRSSAEANLVGVNGGETDERRLESLVY
DELPFSQLGLGFPTTVVAGGSENDVEEVVQAWYMDDDDNAEEDQRLPHRRQPDDLLPLAK
LLDLGLVAMRLDADNHEHDENLKIMREQRGYLHMDIVELTPEKMPNYEVMIKRFFEEHLH
TDEEVRYCLDGSGYFDVRDENDKWVRVSVRKGALIVVPAGIYHRFTLDTNNYIKTMRLFS
GGPDWTAYNRPHDHLPERKKYLEALHNRTPRFGQLHRIRSKME
NT seq 852 nt   +upstreamnt  +downstreamnt
atgatgcaagccaagaagccaagatcaccattgatgatgctcatcgccaagaagccgctg
ctgctgcttcttcttctgctcgttctcctggtgttggagccaagatcatcagcagaagct
aacctcgtcggcgtcaatggcggagagacggatgagaggcggcttgagagcttggtttac
gacgagctgcccttctcccagctcggcttgggattccctaccaccgtcgtcgccggtggc
tccgagaatgatgtggaggaagttgtgcaagcatggtacatggacgacgacgacaacgcg
gaggaagaccagaggcttcctcatcgccgccagcctgatgatcttcttcctctcgccaaa
ttgcttgacctcggactcgttgcaatgcgattagatgcagataaccatgagcacgatgag
aaccttaagataatgcgtgaacagagaggctacttgcacatggacatcgttgaattgacc
ccagagaaaatgccaaattatgaggtgatgatcaagagattcttcgaagaacatctccac
acagatgaagaagttcgctattgtcttgatggtagtggttacttcgatgtgagagatgag
aatgacaagtgggtccgggtttcagtgaggaaaggggcactcatcgttgtgccagccggc
atctatcaccgcttcacacttgataccaacaactacataaagaccatgcgtttattttca
ggtgggccagattggacggcttacaatcgtcctcatgatcatctgcctgaaaggaagaag
tatctagaagcgctgcataacaggaccccgagatttggacaactgcatcgaattcgctca
aaaatggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331707
Entry
4331707           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4331707
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4331707
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     4331707
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     4331707
SSDB
Motif
Pfam: ARD Cupin_2 AraC_binding HSF_DNA-bind Cupin_1 Yuri_gagarin DMSP_lyase APG6_N HALZ
Other DBs
NCBI-GeneID: 4331707
NCBI-ProteinID: XP_015629453
LinkDB
Position
3:3338232..3344523
AA seq 606 aa
MENQFQDGKEEVIEAWYMDDSEEDQRLPHHREPKEFIPLSKLSELGILSWRLNADDWEND
ENLKKIREARGYSYMDICDVCPEKLPNYEAKLKNFFEEHLHTDEEIRYCLEGSGYFDVRD
QNDQWIRVAVKKGGMIVLPAGMYHRFTLDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYVEKIINRGGTQAVEARARCQARRILFLDWSRLGGDDGEDDAGDGEGGVAAELAGGGGG
AEAHGGAARGRAAAVPDQDVRPGGRPGHRRRRLVGPRGQQLRRLGPPRLRRRLPPTLLQA
QQFLQLRPPAQHLPRWIKTADEATRICLFVLEDSFDHHQKKEKGFRKIDPDRWEFANDGF
LRGQRHLLKMIKRRRPLSYLPGSQQALGTCLEVGQFGLDEEIDRLKRDKNILLAEVVKLR
HKQQSTKANMRAMEERLQHAEQKQVQMMGFLARAMQNPDFFHQLIHQQDKMKGLEDTFSK
KRTRSIDIVPFLNPGEVSQGDQLESTLLFDPRPFAELNDEPAKSELENLALNIQGLGKGK
QDVNRTRNQPRNQASNETELTDDFWEELLNEGARDDAGIPGMERRRPRYVDALAQKLGYL
SNSSQK
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagaaccagttccaggatggcaaggaggaggtcatcgaagcttggtacatggatgac
agtgaagaggaccagaggcttcctcatcatcgtgagcccaaagaattcattcctcttagc
aaactttcagagttaggaatattaagctggcgcctgaatgctgatgactgggagaatgat
gagaacctcaagaaaatccgtgaggccaggggatactcttacatggatatttgtgatgtg
tgtccagaaaagctgccaaactatgaggctaagctgaaaaatttctttgaagaacacttg
catactgatgaagagatacgctattgtcttgagggaagtggatacttcgatgtcagggac
caaaatgatcagtggatccgtgtagcagtgaagaaagggggcatgattgttttgcctgcg
ggaatgtatcaccgcttcacattggacagtgacaactacatcaaggcaatgcggctcttt
gtgggagagcctgtctggacgccgtacaaccgtccccatgaccatctgccagctagaaag
gagtatgtcgaaaaaattatcaacaggggtggaactcaagctgtcgaagctcgtgctcgc
tgccaagctcgccggattcttttcttggattggagcagattggggggtgacgatggagaa
gatgatgccggggatggtgaaggaggagtggccgccgagctcgccggaggagggggaggc
gccgaggcccatggaggggctgcacgaggtcgggccgccgccgttcctgaccaagacgtt
cgacctggtggccgacccggccaccgacggcgtcgtctcgtggggccgcgcgggcagcag
cttcgtcgtctgggacccccacgtcttcgccgccgtcttcctcccacgcttcttcaagca
caacaatttctccagcttcgtccgccagctcaacacctacctagatggatcaagacagcg
gatgaagctacaagaatctgcttgtttgttctagaagactcctttgatcaccatcaaaaa
aaagaaaaaggtttcagaaagattgatcctgacagatgggaattcgcgaatgatggtttc
ctgagaggccagaggcatcttctaaagatgattaagaggaggagaccattgtcttatctc
cctggatctcagcaggcacttggcacctgccttgaggttggtcagttcggattagatgaa
gagatcgacaggctaaagcgtgacaagaacatcttactcgcggaggttgtgaaactaagg
cacaagcagcaaagcacgaaagccaatatgcgagccatggaagagaggctgcaacatgcg
gagcagaagcaggtccagatgatgggtttcttggcaagagcaatgcagaaccctgacttc
tttcaccagttgattcaccagcaggataaaatgaaggggctcgaggacacattctcgaag
aagaggacgaggtcgatagacatagtgccatttctcaaccccggggaggtcagccagggc
gatcaactcgagtcgacattgctgtttgatccaaggccatttgctgaactgaatgatgag
cctgcaaagtctgaactggagaatttagcactgaacatccagggtcttgggaagggcaag
caggatgtcaacaggactcgaaatcagccacgaaatcaggctagcaacgaaaccgagtta
accgacgacttctgggaggagcttctgaatgaaggagcaagagatgatgctgggattcca
gggatggagcgaagaagacctagatatgtcgatgcattagcgcagaagctgggttatcta
agcaatagtagccaaaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348646
Entry
4348646           CDS       T01015                                 
Name
(RefSeq) heat stress transcription factor A-2c
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348646
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     4348646
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     4348646
SSDB
Motif
Pfam: ARD HSF_DNA-bind Cupin_2 AraC_binding Cupin_1 DMSP_lyase CtIP_N
Other DBs
NCBI-GeneID: 4348646
NCBI-ProteinID: XP_015613648
LinkDB
Position
10:complement(14746101..14754372)
AA seq 641 aa
MENEFQDGKTEVIEAWYMDDSEEDQRLPHHREPKEFIHVDKLTELGVISWRLNPDNWENC
ENLKRIREARGYSYVDICDVCPEKLPNYETKIKSFFEEHLHTDEEIRYCLEGSGYFDVRD
QNDQWIRIALKKGGMIVLPAGMYHRFTLDTDNYIKAMRLFVGDPVWTPYNRPHDHLPARK
EFLAKLLKSEGENQAVEGFCSVTQKLPNWADLDDELSPSNWATCPPPGPSTCPHLSHPTP
LPPSLHSPEASPRPVATLPYAASRTFHTSPDASRRTARAGGGVMDPAAAGIVKEEMLESQ
QQQRQEDGGAAPRPMEGLHEVGPPPFLTKTYDLVEDPATDGVVSWSRAGNSFVVWDPHVF
ADLLLPRLFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKTIKRRKPPSN
APPSQQQSLTSCLEVGEFGFEEEIDRLKRDKNILITEVVKLRQEQQATKDHVKAMEDRLR
AAEQKQVQMMGFLARAMRNPEFFQQLAQQKEKRKELEDAISKKRRRPIDNVPFYDPGETS
QTEQLDSPYLFDSGVLNELSEPGIPELENLAVNIQDLGKGKVDEERQNQTNGQAELGDDF
WAELLVEDFTGKEEQSELDGKIDGIDELAQQLGYLSSTSPK
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggagaacgaattccaggatggtaagacggaggtgatagaagcatggtacatggatgat
agcgaagaggaccagaggcttcctcatcaccgcgaacccaaagaattcattcatgttgat
aagcttacagaactaggagtaatcagctggcgcctaaatcctgataactgggagaattgc
gagaacctgaagagaatccgcgaagccagaggttactcttatgtggacatttgtgatgtg
tgcccagagaagctgccaaattatgaaactaagatcaagagtttctttgaagaacacctg
cataccgatgaagaaatacgctattgtcttgaagggagtggatactttgatgtgagagac
caaaatgatcagtggattcgtatagcactgaagaaaggaggcatgattgttctgcctgca
gggatgtaccaccgctttacgttggacaccgacaactatatcaaggcaatgcgactgttt
gttggcgatcctgtttggacaccctacaaccgtccccatgaccatcttcctgcaagaaag
gagtttttggctaaacttctcaagtcagaaggtgaaaatcaagcagttgaaggcttctgc
agcgtgacccaaaagctgccaaactgggccgacctcgatgatgagttgtcaccctcaaat
tgggccacctgtccaccacccggcccatccacctgcccccatctgtcccacccaaccccc
ctccccccctctctccactctccagaagcttctccgcggccagtggcgacgctaccctac
gcggcgtctagaaccttccacacctctcccgacgcctctcgacgtacggcgagggcggga
gggggggtcatggacccggcggcggcgggcattgtgaaggaggagatgctggagtcgcag
cagcagcagcggcaggaggatggcggggcggcgccgcggccgatggaggggctgcacgag
gttgggccgccgccgttcctgacgaagacgtacgacctggtggaggacccggccaccgac
ggcgtcgtgtcgtggagccgcgcgggcaacagcttcgtcgtctgggacccgcacgtcttc
gccgacctcctcctcccgcgcctcttcaagcacaacaacttctccagcttcgtccggcag
ctcaacacctacggcttcagaaaggtcgatcctgataggtgggagtttgcaaatgagggt
tttctcaggggccaaaggcatctcctgaaaacgataaagagaaggaagcccccgtccaat
gcacctccgtcacaacaacagtccctcacatcttgtctggaagttggtgagtttggattc
gaggaagaaattgacaggctgaagcgtgataagaacatcttgatcacagaggtagtaaag
ctaaggcaggagcagcaggccactaaagatcatgtgaaagccatggaagataggctacga
gccgctgagcagaaacaggtccagatgatggggttcttggcaagagcaatgcgcaaccca
gagttcttccagcagttggcacagcagaaagagaagaggaaggagcttgaggatgccatc
tcgaagaaaagaaggcggcctatagacaatgttccattctatgaccctggggaaacaagt
cagactgagcaacttgattcgccgtatttgtttgattcaggtgtgcttaatgagttaagt
gaacctggaatccctgagctggagaatctcgcagtgaacattcaggatctggggaagggt
aaagtagatgaagagaggcagaatcaaactaatggtcaggcagagctcggagatgacttc
tgggcagagctgttggttgaagatttcacaggcaaggaggagcagtcagagttggatggc
aaaattgacggcatcgacgaactggctcaacagttggggtatctgagctctactagtcca
aaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348647
Entry
4348647           CDS       T01015                                 
Name
(RefSeq) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348647
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     4348647
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     4348647
SSDB
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 DMSP_lyase 3-HAO Cupin_8 JmjC_2
Other DBs
NCBI-GeneID: 4348647
NCBI-ProteinID: XP_015612793
UniProt: Q7XEJ5
LinkDB
Position
10:complement(14757124..14759811)
AA seq 184 aa
MAHLVWMLGENGEEKSFENPNELLPLSRLEEIGVLYWHLDPKKSESEEELTKIRRERGYS
YFDLTEICPDKLENYEEKLKSFYCEHIHADEEIRYCLEGSGYFDVRDKDDKWIRIWIKEG
DMIILPAGIYHRFIVDSNNYIKLMRLFIGEPVWTAYNRPQEDHPVRQEYVKNVKGDTGFA
LAAH
NT seq 555 nt   +upstreamnt  +downstreamnt
atggctcatctggtatggatgctgggggagaacggagaggagaagagcttcgagaatccc
aacgagttgctgccactctccagacttgaagagatcggtgtgttgtattggcacttggat
cctaagaagtctgaaagcgaagaagagctcacaaaaatccgcagagaaagaggatacagc
tactttgatcttactgagatatgccctgataaattggaaaattatgaggagaagctgaag
agcttctattgtgagcacattcatgctgatgaagagatccggtactgcttggagggtagc
ggttactttgatgtccgtgacaaggatgacaaatggattcggatttggataaaagaggga
gacatgatcatcctgccagctgggatttatcatcggttcatcgtcgacagcaacaactat
atcaagctcatgaggctcttcattggagaaccagtctggaccgcatacaaccggccacag
gaagaccatcctgtgaggcaagagtatgtcaagaatgtgaagggggacaccggatttgct
cttgccgcacattga

DBGET integrated database retrieval system