KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276116
Entry
107276116         CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor 1-like
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107276116
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107276116
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107276116
   04031 GTP-binding proteins [BR:osa04031]
    107276116
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    107276116
  Arf GTPases and associated proteins
   Arf GTPases
    107276116
 Endosome - Golgi transport
    107276116
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   107276116
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    107276116
SSDB
Motif
Pfam: Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 107276116
NCBI-ProteinID: XP_015642612
UniProt: A0A0P0WS64
LinkDB
Position
6:819225..820550
AA seq 189 aa
MGQSLRKLFDSFCTKEMKVLMLGLDAAGKTTILYRLHIGEVLSSIPTIGFNVEKVEYKNV
AFTVWDVGGQDKLRPLWRQYFRNADALIYVVDSMDRERIGVAKEEFQAIIRDPLMLNSVI
LLLANKQDLKGAMSSSEVCQRLGAYEELKNRRWHCQGASALTGDGLHGGLDWLASTLRDV
QTWGTSVRF
NT seq 570 nt   +upstreamnt  +downstreamnt
atggggcagtccctgaggaagctgttcgacagcttctgcacaaaggagatgaaggttctg
atgcttgggctggatgctgctgggaagacgacgattctgtacaggctgcacattggcgaa
gttctgtcctccatacccacaatcgggttcaacgtggagaaggtggagtacaagaacgtg
gccttcacggtgtgggacgtgggaggccaggacaagctccgacctctctggagacaatac
ttcagaaacgccgacgccctgatctacgtggttgattcgatggacagggaaaggatagga
gtagccaaggaggagttccaggccatcatccgcgaccccctcatgctcaacagcgtcatc
ctcctcctcgccaacaagcaggacctgaaaggggcgatgagctcgtcggaggtgtgccag
cggctgggggcgtacgaggagctcaagaaccggaggtggcactgtcagggagcctcagcg
ctcaccggcgacggcctccacggcggcctcgactggctggcctccaccctccgcgacgtc
cagacgtggggcacctccgtccgcttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326208
Entry
4326208           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor 2-like isoform X1
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4326208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326208
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326208
   04031 GTP-binding proteins [BR:osa04031]
    4326208
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4326208
  Arf GTPases and associated proteins
   Arf GTPases
    4326208
 Endosome - Golgi transport
    4326208
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4326208
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4326208
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4326208
NCBI-ProteinID: XP_015611313
UniProt: A0A0P0V1B9 Q9LDC9
LinkDB
Position
1:complement(9019847..9024158)
AA seq 181 aa
MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANK
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atgggcctcactttcacgaagcttttcagccgcctcttctccaagaaggagatgaggatc
ctcatggtcggtctcgacgcagctggtaaaaccacaattctctacaagctcaagcttgga
gagattgtcaccaccattccaacaatagggtttaatgtggagactgttgaatacaagaac
attagcttcactgtctgggatgtcgggggtcaagacaagatcagacctttgtggaggcac
tatttccagaacactcaaggtctcatctttgttgttgatagcaacgacagagatcgtgtg
gttgaggcaagggatgaactccacaggatgcttaatgaggatgagttgagggatgcggtg
ttgctggtttttgctaacaagcaagatcttcctaatgcaatgaatgctgctgagatcaca
gataagcttggtctccattccctgcgccaacgccactggtatatccagagtacatgcgcc
acaacaggagagggtttatatgagggccttgactggctctcgagcaacattgcaaacaag
gcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327591
Entry
4327591           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor 1
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4327591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327591
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327591
   04031 GTP-binding proteins [BR:osa04031]
    4327591
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4327591
  Arf GTPases and associated proteins
   Arf GTPases
    4327591
 Endosome - Golgi transport
    4327591
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4327591
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4327591
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4327591
NCBI-ProteinID: XP_015618373
UniProt: Q06396
LinkDB
Position
1:34580331..34583603
AA seq 181 aa
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atggggctcacgttcacgaagctgttcagccgcctcttcgcgaagaaagagatgaggatt
ctcatggtcgggctcgatgcagccggtaagaccaccatcctctacaagctcaagcttggc
gagatcgtcacgaccatccccaccatcggatttaatgttgaaaccgtggaatacaagaac
atcagcttcactgtttgggatgtcggtggccaggacaagatcaggcccctgtggaggcac
tatttccagaacacacagggactcatctttgttgtggacagcaatgatagggagcgtgtt
gttgaggccagagacgagcttcacaggatgctgaacgaggatgagctgcgtgatgctgtg
ctgcttgtatttgcaaacaaacaagatcttcctaatgccatgaatgcagctgaaatcact
gacaagcttggtttgcattccctgcgccagaggcactggtacattcagagcacttgtgct
acatctggtgaagggttgtatgagggtcttgactggctttccaacaacattgccagcaag
gcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328177
Entry
4328177           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4328177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328177
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328177
   04031 GTP-binding proteins [BR:osa04031]
    4328177
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4328177
  Arf GTPases and associated proteins
   Arf GTPases
    4328177
 Endosome - Golgi transport
    4328177
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4328177
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4328177
SSDB
Motif
Pfam: Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4328177
NCBI-ProteinID: XP_015623111
UniProt: Q6Z6Z4 A0A0P0VE95
LinkDB
Position
2:1476318..1480275
AA seq 194 aa
MGQALRRLFDAFFSTREMRVVMLGLDAAGKTTILYRLHMGEVLSTVPTVGFNVEKVQYKN
VVFTVWDVGGQEKLRPLWKMYLSNSDALIYVVDSLDRERIIDARQEFQTIIKDPLMANSI
ILVFANKQDLRGAMSPDEVSEGLGLHDLRNRIWHIQGTCALRGEGLYDGLDWLASTLKQL
QETGHATSVAGPSI
NT seq 585 nt   +upstreamnt  +downstreamnt
atggggcaagctctgcggcggctcttcgacgccttcttctccaccagggagatgcgggtt
gtgatgcttggtttggatgcagctggcaagacaacaattttgtataggctgcacatggga
gaagttctttcaacggttcctacagtaggttttaacgtagagaaggttcagtacaagaat
gtggtatttactgtgtgggatgttggcggacaagaaaagctcaggccattatggaagatg
tacctcagcaattctgatgcactgatctacgttgttgattcattggacagagaaaggatt
atagacgccagacaagaatttcagaccattatcaaggacccactgatggcaaacagcata
atcttagtatttgcaaacaaacaggacctgagaggtgcgatgagcccagatgaggtgagc
gaggggctaggcctgcacgacctcaggaacaggatatggcatatacaagggacatgcgct
ctccgtggtgagggactctacgatggacttgattggctcgcatccaccctgaagcaattg
caagagacaggccatgcaacttcagtcgccggcccttccatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330422
Entry
4330422           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4330422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330422
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330422
   04031 GTP-binding proteins [BR:osa04031]
    4330422
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4330422
  Arf GTPases and associated proteins
   Arf GTPases
    4330422
 Endosome - Golgi transport
    4330422
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4330422
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4330422
SSDB
Motif
Pfam: Arf Roc G-alpha SRPRB Ras Gtr1_RagA MMR_HSR1 6PF2K Nucleopor_Nup85
Other DBs
NCBI-GeneID: 4330422
NCBI-ProteinID: XP_015625968
UniProt: Q6Z8E3
LinkDB
Position
2:28755175..28758579
AA seq 194 aa
MGQAFRKLFDAFFGTSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKN
VMFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKAEFQAIVNDPLMLNSV
ILVFANKQDMKGAMTPLEVCEGLGLYDLKNRIWHIQGSCALKGDGLYEGLDWLASTLKGL
EASGRLPSGGTSLF
NT seq 585 nt   +upstreamnt  +downstreamnt
atggggcaggcgttccgcaagctgttcgatgccttcttcggcaccagcgagatgagggtc
gtgatgcttgggctggatgccgcgggcaaaaccaccatcctgtacaagctgcacatcggg
gaggtcctttcgactgttcctacgattgggttcaatgttgagaaagtacagtacaagaac
gtgatgtttacagtatgggatgtcggtggccaagagaagttgaggcctctgtggaggcat
tacttcaataatacggatggtttgatctatgtagttgattcattggatagagagagaatc
ggaaaagcgaaagcggagtttcaggcaatcgttaatgatcctttgatgcttaacagtgta
atattggtatttgccaataaacaagatatgaaaggggcaatgacgccgttggaggtgtgc
gaaggccttggcctctatgatttaaagaatcgcatctggcatatccaaggctcttgtgcc
ctcaaaggtgatggtctttatgagggcttggactggttggcaagtactctgaagggactg
gaagcctcaggtcgcctcccctcaggagggacctcattgttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334545
Entry
4334545           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor 1-like
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334545
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334545
   04031 GTP-binding proteins [BR:osa04031]
    4334545
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4334545
  Arf GTPases and associated proteins
   Arf GTPases
    4334545
 Endosome - Golgi transport
    4334545
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4334545
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4334545
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4334545
NCBI-ProteinID: XP_015632514
UniProt: Q7XZG0 A0A0P0W556
LinkDB
Position
3:34006903..34009631
AA seq 181 aa
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atggggctcacgttcaccaagctgttcagccggctcttcgccaagaaggagatgcggatc
ctgatggtgggtcttgacgcggccggaaagaccacaatcctctacaagctcaagctcggc
gagatcgtcaccaccatccccaccatcggattcaatgttgaaaccgtggagtacaagaac
atcagcttcaccgtctgggatgtggggggtcaggacaagatcaggcctctgtggaggcat
tatttccagaacacccagggtctcatctttgttgtggacagcaatgatagggaccgtgtt
gtcgaagccagggatgagctccacaggatgctgaacgaggatgagctacgtgatgctgtg
ctgcttgtctttgctaacaagcaagatctgccaaacgctatgaatgctgctgagatcact
gataagcttggactgcactcccttcgccagcgacactggtatatccagagcacttgtgct
acaacaggtgagggattgtacgagggcctggactggctgtccagcaacattgccagcaag
gcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339157
Entry
4339157           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor 2
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4339157
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339157
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339157
   04031 GTP-binding proteins [BR:osa04031]
    4339157
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4339157
  Arf GTPases and associated proteins
   Arf GTPases
    4339157
 Endosome - Golgi transport
    4339157
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4339157
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4339157
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4339157
NCBI-ProteinID: XP_015638732
UniProt: P51823 A0A8J8XJL3 Q0DH67
LinkDB
Position
5:complement(24057356..24060616)
AA seq 181 aa
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atggggctcacgttcacgaagctgttcagccgcctcttcgccaagaaggagatgaggatc
ctcatggtcggtctcgatgcggccggtaaaaccaccatcctctacaagctcaagctcggc
gagatcgtcaccactatccccaccatcggttttaatgtcgaaactgttgagtacaagaac
attagcttcaccgtttgggatgttggtggtcaggacaagatcaggcccctgtggaggcac
tatttccagaacacccagggcctcatttttgttgtggacagcaatgacagagagcgtgtt
gttgaggccagggatgagctccaccgtatgctgaatgaggatgagctacgtgatgctgtg
ctgctggtgtttgcaaacaaacaagatcttcctaatgccatgaacgctgctgagatcacc
gacaagcttggtctgcactccttgcgccagcggcactggtacatccagagcacatgtgct
acctctggtgaggggttgtatgaggggcttgactggctttccaacaacattgccaacaag
gcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342745
Entry
4342745           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor 1
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4342745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342745
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342745
   04031 GTP-binding proteins [BR:osa04031]
    4342745
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4342745
  Arf GTPases and associated proteins
   Arf GTPases
    4342745
 Endosome - Golgi transport
    4342745
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4342745
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4342745
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4342745
NCBI-ProteinID: XP_015647034
UniProt: Q7F270 A0A0P0X407
LinkDB
Position
7:6809204..6812438
AA seq 181 aa
MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atggggttggcgttcgggaagctgttcagccggctgttcgcgaagaaggagatgcggatc
ctgatggtcggtctcgacgccgccggaaagaccaccatcctctacaagctcaagctcggc
gagatcgtcaccaccatccccaccattgggttcaacgttgaaactgttgagtacaagaac
attagcttcactgtttgggatgtcgggggtcaggacaagatcagacctctttggaggcat
tacttccagaacacacagggtcttatctttgttgttgatagcaatgatcgggaccgtgtt
gtggaagctagagatgagctccacaggatgctgaatgaggatgagttgcgtgatgctgtt
ttgcttgtgtttgccaacaagcaagatcttccaaatgctatgaatgctgctgagatcact
gataagcttggactgcactcccttcgccagcgacactggtacatccagagcacttgtgcc
acaactggtgagggtctgtacgagggcctggattggctgtccagcaacattgctagcaag
gcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342746
Entry
4342746           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor 1
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4342746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342746
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342746
   04031 GTP-binding proteins [BR:osa04031]
    4342746
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4342746
  Arf GTPases and associated proteins
   Arf GTPases
    4342746
 Endosome - Golgi transport
    4342746
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4342746
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4342746
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4342746
NCBI-ProteinID: XP_015647032
UniProt: Q7F270 A0A0P0X407
LinkDB
Position
7:6822624..6825676
AA seq 181 aa
MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atggggttggcgttcgggaagctgttcagccggctgttcgcgaagaaggagatgcggatc
ctgatggtggggctcgacgccgccggaaagaccaccatcctctacaagctcaagctcggc
gagatcgtcaccaccatccccaccattgggttcaatgttgaaactgttgagtacaagaac
attagcttcactgtctgggatgtggggggtcaagacaagatcagacctctttggaggcat
tacttccagaacacacagggtcttatctttgttgtggatagcaatgatcgcgaccgtgtt
gtggaagctagagatgagctgcacaggatgctgaatgaggatgagttgcgtgatgctgtg
ttgcttgtgtttgccaacaagcaagatcttccaaacgctatgaatgctgctgagattact
gataagcttggattacattcccttcgtcagcgtcactggtacatccagagcacttgtgcc
acaactggcgagggtttgtatgagggcctggattggctgtccagcaacattgctagcaag
gcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349518
Entry
4349518           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor isoform X1
  KO
K07937  ADP-ribosylation factor 1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4349518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349518
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349518
   04031 GTP-binding proteins [BR:osa04031]
    4349518
Membrane trafficking [BR:osa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    4349518
  Arf GTPases and associated proteins
   Arf GTPases
    4349518
 Endosome - Golgi transport
    4349518
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349518
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    4349518
SSDB
Motif
Pfam: Arf G-alpha Roc SRPRB Ras Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 4349518
NCBI-ProteinID: XP_015614384
UniProt: Q336M3 A3C7P6
LinkDB
Position
10:23146468..23148634
AA seq 192 aa
MGQAFRKLFDAFFGNKEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKN
VVFTVWDVGGQEKLRPLWRHYFNNTDALIYVVDSLDRERIGRARAEFQAIINDPFMLNSV
LLVFANKQDMRGAMTPMEVCEGLGLYDLNNRIWHIQGTCALKGDGLYEGLDWLATTLDEM
RASGRITSTSSS
NT seq 579 nt   +upstreamnt  +downstreamnt
atggggcaggccttccgcaagctcttcgacgccttcttcggcaacaaggagatgcgggtg
gtgatgcttgggctagatgccgcggggaagaccaccatactctataagctgcacatcggc
gaagttctctccaccgtccccactataggcttcaacgtggagaaagttcaatacaagaat
gtggtgttcactgtgtgggatgttggtggccaggaaaaattgaggcccttatggaggcac
tacttcaacaacaccgatgctctgatctacgtagttgattccctggatagagagaggatt
gggagagccagagctgaatttcaggccattattaatgacccttttatgcttaatagtgtt
ctattggtgtttgctaacaagcaagacatgaggggcgcaatgactccgatggaagtatgc
gagggccttggtctatatgacctgaacaaccgtatatggcatatccaaggaacctgtgct
ctcaaaggcgatggcctctatgaaggattggactggttagcaacaactctggatgagatg
cgagcttcagggcggataacttcaacatcatcgtcatga

DBGET integrated database retrieval system