KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276120
Entry
107276120         CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    107276120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    107276120
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     107276120
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    107276120
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Other DBs
NCBI-GeneID: 107276120
NCBI-ProteinID: XP_015638939
UniProt: Q6I5D0
LinkDB
Position
5:complement(6975543..6978100)
AA seq 392 aa
MPGTATAAVVDSRPCTQHAEGPAAVLAIGTANPTNIVYQDGFTDYYFGLTESEHLTELKD
KMKRICHRSGIEKRYIHLDEKLIREHPEIIDKHMPSLETRVDIVTTEIPKLAESAARKAI
AEWGRPAIDITHLIFSTYSGCSAPSADLKLASLLGLNPSVSRTILSLHGCSGGGRALQLA
KELAENNRDARVLIACAELTLICFSNPDESKIVGHGLFGDGAGAIIVGADPLVDGERPLF
EMVLASQTTIPGTEHALGMQTTSNGIDFHLSIQVPTLIKDNIRQCLLNTFRSVGNMDPNW
NDLFWAVHPGGRAILDNIEGELQLQPAKLAASRHVLSEYGNMSGTTIAFVLDELRCRREK
EGDEHQQPEWGVMLAFGPGITIEAMVLRNPLS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgcctggaacagctactgccgctgttgttgacagccgcccgtgcacacagcacgcggaa
ggccctgctgcggtcctcgccatcggcactgcaaaccccacaaatatcgtctatcaagat
gggtttaccgactactacttcggtctaaccgagagcgagcatcttactgagctgaaggac
aaaatgaagagaatatgtcacaggtcaggaatagagaaacgctacatccaccttgatgaa
aagctcatccgtgagcacccggagatcatcgacaaacacatgccctcccttgaaactcgt
gtagacatcgtcaccactgagatcccaaagctcgctgagtccgccgcacggaaggccatc
gccgagtggggccgtcctgccattgatattacccacctcatcttcagcacctactccggg
tgcagtgctcctagcgctgacctcaagctggcatcactactcgggctcaacccttctgtc
tctcgcaccatcctcagcctccacggttgctctggaggcggtagggccctccaacttgcc
aaggagcttgccgagaacaaccgcgatgcacgcgttctcatagcctgcgccgagctgacg
ctgatatgcttctcaaacccagatgaaagcaaaatcgtcggccatggactatttggggat
ggtgccggagcaatcattgtcggcgctgacccattggtcgatggagaacgcccgctgttt
gagatggtccttgcctcgcaaacaacgataccaggtactgagcatgcacttggcatgcag
accaccagcaatggcatagatttccacctctctatccaggtgccgacgctaatcaaggac
aacatccgacaatgcttgctcaacacattccgatcggttggaaacatggatcctaattgg
aatgacctcttctgggcggtgcaccctggtggccgtgcaatccttgacaacatagaaggt
gagcttcagctgcaaccagcaaagcttgcggcaagccgccatgtgcttagcgagtacggg
aatatgagtggcacgacgatcgcgtttgttcttgatgagttgcgttgtcgtcgggagaag
gaaggagatgagcatcaacaacctgagtggggagtaatgctagcctttggaccaggtatc
acaatagaggcaatggtgttgcgtaacccactctcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276706
Entry
107276706         CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    107276706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    107276706
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     107276706
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    107276706
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Other DBs
NCBI-GeneID: 107276706
NCBI-ProteinID: XP_015613230
UniProt: A3A9M8
LinkDB
Position
10:4226838..4229400
AA seq 398 aa
MPGATTAAIVDSRRCTQHSEGPATVLAIGTANPENIILQDDFADYYFGLTKSEQLTELKD
KMKRICHKSGIEKRYIHLNAEIIRAHPEIIDKHVPSLETRVDIVATEVPKLAESAARKAI
AEWGRPATDITHLIFSTYSGCRAPSADLQLASLLGLRPSVSRTILSLHGCSGGGRALQLA
KEIAENNRGARVLVACSELTLICFSTPDESKIVGHGLFGDGAGAVIVGADPSADGEHPLF
EMVAASQTMIPGTEHALGMQATSSGIDFHLSIQVPTLIKDNIHQCLLDVFRSVGNTDPNW
NDLFWAVHPGGRAILDNIEDKLQLQPWKLAASRQVLSEYGNMSGATIAFVLDELRRHREK
EEDMQQQPEWGVLLAFGPGVTIETIVLRNPLSRGLKEN
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgcctggagcaactaccgccgctattgttgacagccgcaggtgcacacagcattcggaa
ggccctgccacggtcctcgccatcggcactgcaaacccggaaaacatcatccttcaagat
gactttgctgactactactttggtctaaccaaaagcgagcaacttactgagttaaaggac
aagatgaaaaggatatgtcataaatctggtatagagaagcgctatatccaccttaatgcc
gagatcatccgtgcccacccagagatcattgacaaacacgtgccctcccttgaaacccgt
gtagacatcgtggctaccgaggtccccaagctcgccgagtccgctgcacggaaagccatt
gctgagtggggtcgtccggctactgacatcacccaccttatcttcagcacctactcaggt
tgtcgtgcacctagcgctgacctccaattggcgtcattgctcggacttcgcccttccgtt
tctcgcaccattctcagtcttcacggctgctcaggtggtggcagggcactccagcttgca
aaggagattgccgagaataaccgcggtgcgcgtgtcctcgtagcctgctctgagctgacc
ctgatatgcttctctaccccggatgaaagtaaaatcgttggccatggactgttcggggat
ggtgctggcgcagtcatcgtcggtgccgacccctcggccgatggcgagcatccactattt
gagatggttgccgcctcacaaaccatgataccaggaactgagcacgcactcggaatgcag
gccactagtagtggcatagattttcacctctccatccaggtgccgacattgataaaggac
aacatccatcagtgcttgctcgatgtgttccgatctgtcggaaacacagatcctaactgg
aacgacctcttctgggcagtgcaccctggcggccgcgcgatccttgataacatagaggac
aagctccaactgcagccatggaagcttgcggcgagccgccaagtgctgagcgagtacggg
aacatgagtggtgcaacaattgcatttgttcttgatgaactacgccgccatcgggagaag
gaagaagacatgcagcaacagcctgagtggggagtgttgctggcctttggacctggagtc
acaatagagacaatcgtgctgcgtaacccactctcacgtggtttgaaggaaaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276873
Entry
107276873         CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    107276873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    107276873
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     107276873
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    107276873
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Other DBs
NCBI-GeneID: 107276873
NCBI-ProteinID: XP_015638862
UniProt: Q6I5C6
LinkDB
Position
5:complement(7003773..7005509)
AA seq 392 aa
MPGAATAAVVDSRQCKQHAEGPAAVLAIGTANPTNIVYQDGFADYYFGLTKSEHLTELKD
KMKRICHRSGIEKRYIHLDEKLIREHPEIIDKHMPSLENRVDIVTTEIPKLAESAARKAI
AEWGRPATDITHLIFSTYSGCSAPSADLKLASLLGLNPSVSRTILSLHGCSGGGRALQLA
KELAENNRDARVLIACAELTLICFSNPDESKIVGHGLFGDGAGAIIVGADPLVDGERPLF
EMVLASQTTIPGTEHALGMQTTCSGIDFHLSIQVPMLIKDNIRQCLLDTFRSVGNMNPNW
NDLFWAVHPGGRAILDNIEGELQLQPTKLAASRHVLSEYGNMSGTTIAFVLDDLRRRQEK
EGDEHEQPEWGVMLAFGPGITIEAMVLRNPLS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgcctggagcagctactgccgcagttgttgacagccgccagtgcaaacagcacgcggaa
ggccctgctgcggtcctcgccatcggcactgcaaaccccacaaatatcgtctatcaagat
gggtttgccgactactacttcggtctaaccaagagcgagcatcttaccgagctgaaggac
aaaatgaagagaatatgtcatagatcaggaatagagaaacgctacatccaccttgatgaa
aagctcatccgtgagcacccggagatcatcgacaaacacatgccttcccttgaaaatcgc
gtagacatcgttaccactgagatcccgaagctcgcggagtctgctgcacgaaaggccatc
gccgagtggggccgtccggccactgacattacccacctcattttcagcacctactctggg
tgcagtgctcctagtgctgacctcaagctagcatcactacttggcctcaacccttctgtc
tctcgcaccatccttagcctccacggttgctctggaggtggtagggccctccaacttgcc
aaggagcttgccgagaacaatcgcgatgcacgcgttctcatagcctgcgccgagttgacg
ctgatatgcttctcaaacccagatgaaagcaaaatcgtcggccatggactatttggggat
ggtgccggagcaatcattgtcggcgctgacccattggtcgatggagagcgcccgctgttt
gagatggtccttgcctcgcaaacaacgataccaggtactgagcatgcacttggcatgcag
accacctgcagcggcatagatttccacctctctatccaggtgccaatgctgatcaaggac
aacatccggcagtgcttgctcgacacattccgatcggttggaaacatgaatcctaattgg
aatgacctcttttgggcggtgcaccctggtggccgtgcgatccttgacaacatagaaggc
gagcttcagctgcagccaacaaagcttgcagcaagccgccatgtgctgagcgagtacggg
aatatgagtggcacgacgattgcgttcgttctggatgacttgcgtcgccgtcaggagaag
gagggagatgagcatgaacaacctgagtggggagtaatgctagcctttggaccgggtatc
acaatagaggcaatggtgctgcgtaacccgctctcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278066
Entry
107278066         CDS       T01015                                 
Name
(RefSeq) chalcone synthase 1-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    107278066
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    107278066
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     107278066
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    107278066
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III FAE1_CUT1_RppA ACP_syn_III_C
Other DBs
NCBI-GeneID: 107278066
NCBI-ProteinID: XP_015645991
LinkDB
Position
7:complement(18852472..18864631)
AA seq 409 aa
ITPAPLAASAAAAAAATTVTTQDIRRAQRADGPATVLAIATANPETRRSQDEYADFYFRV
TKSEHLPQLKEKLERICKKSGIENRYTYVNDEVMKAHPEFSDRKLPSLDARVEIASNAVP
ELAAAAASMAIAEWGRPATDITHLIFSTYSDLKAPSSDRRLASLLGLRHTVCRTILSLHG
CYGGCRALQLAKELAENNRGARVLVACSEISLIAFYGPEEGYTDTDTLVAHALFGDGSGA
VIVGADPVDAVERPLFEMAFASQTTVPDSEGAITVQHKKGGMEYHIARGLPEMLAGNIKR
CLADAFGAIGVAARWKDLFWAVHPGGRRILDLIEEALGLDNGAMAASRQVLREYGNMSGT
TVIFVLNELRRRFAADGAEGADWGALMAFGPGITAETILLRVASGLKGN
NT seq 1230 nt   +upstreamnt  +downstreamnt
atcacgcccgcgccgctcgccgctagcgccgccgccgcagcggcggccaccaccgtcacc
actcaagatatccggcgagcacagcgcgccgatggcccggccaccgtgctcgccatcgcc
acggctaacccggagactcgcagatcgcaggatgaatatgccgacttctacttccgcgtc
accaagagcgagcatctccctcagctcaaggagaagctcgagaggatctgtaagaaatcc
ggcatcgaaaatcggtacacgtacgtgaacgacgaggtcatgaaggcccatccagagttc
tccgatcgcaagcttccatccctcgatgcgagggtagagatcgcttccaacgccgtgccg
gagctcgccgcggccgccgcgtcgatggccatcgcagaatgggggcgcccggccaccgac
atcacccacctcattttcagcacatactctgacttgaaggccccgagcagcgaccgccgg
ctggcgtcgctcctcgggctccgccataccgtctgccgcaccatccttagcctccacggc
tgctacggcggctgcagggcactccagctcgccaaggaactcgccgagaacaaccgcggt
gcgcgcgtcctcgtcgcctgctccgagatcagcctcatcgcgttctacggcccggaggag
ggctacacagacacagacaccttggttgcccatgcgctgttcggcgacggctcgggcgcc
gtcatcgtcggcgccgacccggtcgacgccgtggagcgcccgctgttcgagatggcattc
gcgtcgcagaccaccgtccccgacagcgagggcgccatcacagtccagcacaagaagggc
ggtatggagtaccacatcgccagaggcttgccggagatgctcgccggcaacatcaagcgg
tgcctggccgacgcgttcggcgccatcggcgtcgccgccaggtggaaggacctcttctgg
gccgtccaccctggcggccgcaggatcctggacctcatcgaggaggcgctcgggctggac
aacggcgccatggcggcgagccggcaggtgctgcgcgagtacggcaacatgagcggcacc
acggtgatcttcgtgctcaacgagctgcgccgccggttcgccgccgacggcgccgagggc
gccgactggggcgcgttgatggcgttcgggccggggatcaccgccgagacgatcttgctc
cgcgtcgcaagtggcctcaagggaaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338103
Entry
4338103           CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4338103
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    4338103
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     4338103
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    4338103
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Other DBs
NCBI-GeneID: 4338103
NCBI-ProteinID: XP_015638835
UniProt: B9FIV6 Q0DJY7
LinkDB
Position
5:complement(6990226..6993723)
AA seq 392 aa
MPGAAAAAVVDSRLCTQHAEGPAAVLAIGTANPANIVYQDGFADYYFGLTKSEHLIELKD
KMKRICHRSGIEKRYIHLDDKLICEHPEIIDKHMPSLETRVDIVSTEVPKLAESATRKAI
AEWGRPAIDITHLIFSTYSGCSAPSADLKLASLLGLNPSVSRTILSLHGCSGGGRALQLA
KELTENNRDARVLVACAELTLICFSNPDESKIVGHGLFGDGAGAIIVGAGPLVDEERPLF
EMVLASQTTIPSTEHALGMQTTASGIDFHLSIQVPTLIKDNIRQCLLDTFRSVGNMDPNW
NDLFWAVHPGGRAILDNIEGELQLQPAKLAASRHVLNEYGNMSGTTIAFVLDDLRRRREK
EGDQHQQLEWGVMLAFGPGITIEAMVLRNPLS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgcctggagcagctgctgccgctgttgttgacagccgcctgtgcacacagcacgcggaa
ggccctgctgcggtcctcgccatcggcactgcaaacccggcaaatatcgtctatcaagat
gggtttgccgactactactttggtctaaccaagagcgagcatcttattgagctgaaggac
aaaatgaagaggatatgtcacagatcgggaatagagaaacgctacatccaccttgatgac
aagctcatctgtgagcacccggagatcatcgacaaacacatgccctcccttgaaactcgt
gtagacatcgtctctactgaggtcccgaagctcgccgagtcagccacacggaaggccatc
gccgagtggggccgtccggccattgacattacgcacctcatcttcagcacctactccggg
tgcagtgctcctagcgctgacctcaagctggcatcactactcggcctcaacccttctgtt
tctcgcaccatccttagcctccacggttgctctggaggcggtagggcacttcaacttgcc
aaggagctcaccgagaacaaccgtgatgcacgcgttctcgtagcctgtgccgagctgacg
ctaatatgcttctcaaacccagatgaaagcaaaattgtcggccatggactgtttggggat
ggtgccggagcaatcattgtcggcgctggcccactggtcgatgaagagcgcccactattc
gagatggtcctcgcctcgcaaacaacgataccaagtactgagcatgcacttggcatgcag
accaccgccagtggcatagatttccacctctctatccaggtgccaacactgatcaaggac
aacatccggcagtgcttgcttgacacattccgatcggttggaaacatggatcctaattgg
aatgacctcttctgggcagtgcaccctggtggccgtgcgatccttgacaacatagaaggc
gagcttcagctgcaaccagcaaagcttgcggcaagccgccatgtgttgaacgagtatggg
aatatgagcggcacgacgatcgcgtttgttcttgatgacttgcgtcgccgtcgggagaag
gaaggagatcagcatcaacaacttgagtggggagtaatgctagcctttggaccaggtatc
acaatagaggcaatggtgctgcgtaacccactctcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342896
Entry
4342896           CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4342896
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    4342896
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     4342896
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    4342896
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C FAE1_CUT1_RppA ACP_syn_III_C ACP_syn_III
Other DBs
NCBI-GeneID: 4342896
NCBI-ProteinID: XP_015646196
UniProt: Q8LIL0
Structure
LinkDB
Position
7:10018732..10020736
AA seq 402 aa
MAPTTTMGSALYPLGEMRRSQRADGLAAVLAIGTANPPNCVTQEEFPDFYFRVTNSDHLT
ALKDKFKRICQEMGVQRRYLHHTEEMLSAHPEFVDRDAPSLDARLDIAADAVPELAAEAA
KKAIAEWGRPAADITHLVVTTNSGAHVPGVDFRLVPLLGLRPSVRRTMLHLNGCFAGCAA
LRLAKDLAENSRGARVLVVAAELTLMYFTGPDEGCFRTLLVQGLFGDGAAAVIVGADADD
VERPLFEIVSAAQTIIPESDHALNMRFTERRLDGVLGRQVPGLIGDNVERCLLDMFGPLL
GGDGGGGWNDLFWAVHPGSSTIMDQVDAALGLEPGKLAASRRVLSDYGNMSGATVIFALD
ELRRQRKEAAAAGEWPELGVMMAFGPGMTVDAMLLHATSHVN
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcaccgacgacgaccatgggaagcgccttatacccgctcggcgaaatgcggcggtcg
cagcgcgccgacgggctcgccgccgtgctcgccatcggcaccgccaaccctcccaactgc
gttacccaggaggagttccccgacttctacttccgcgtcaccaacagcgaccacctcact
gccctcaaggacaagttcaagcgtatctgtcaggaaatgggcgtgcagaggcggtacctg
caccacacggaggagatgctgtccgcacacccggagttcgtggaccgcgacgcgccgtcg
ctcgacgcgcggctggacatcgccgcggacgccgtgccggagctggcggcggaggccgcc
aagaaggcgatcgccgagtggggccgcccggccgccgacatcacccacctcgtcgtcacc
accaactccggcgcccacgtcccgggtgtcgacttccgcctcgtcccgctcctcggcctc
cgcccctccgtgcgccgcaccatgctccacctcaacggctgcttcgccggctgcgccgcg
ctccgcctcgccaaggacctcgccgagaacagccgcggcgcgcgcgtcctcgtcgtcgcc
gccgagctcaccctcatgtacttcaccgggcccgacgagggctgcttcaggacgctcctc
gtccagggcctgttcggcgacggcgcggccgccgtcattgtcggcgccgacgccgacgac
gtcgagcgcccgctgttcgagatagtgtcggcggcgcagacgatcatcccggagtcggac
cacgccctgaacatgcggttcacggagcgccgcttggacggcgtcctcgggcggcaggtc
ccggggctcatcggggacaacgtcgagcggtgcctcctggacatgttcggcccacttctc
ggcggcgacggcggcggcgggtggaacgacctgttctgggcggtgcacccgggctcgtcg
acgatcatggaccaggtcgacgcggcgctcggcctcgagcccggcaagctggcggcgagc
cgccgtgtgctcagcgactacgggaacatgtctggcgctacggtgatcttcgcgctggac
gagctgcgccggcagcgcaaggaggcggcggcggcgggtgaatggccggagttgggagtg
atgatggcgttcggcccggggatgaccgttgatgcgatgctgttgcacgccacctctcat
gtgaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343313
Entry
4343313           CDS       T01015                                 
Name
(RefSeq) chalcone synthase 1
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4343313
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    4343313
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     4343313
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    4343313
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III_C ACP_syn_III FAE1_CUT1_RppA
Other DBs
NCBI-GeneID: 4343313
NCBI-ProteinID: XP_015646281
UniProt: Q69RP8 Q6ZIJ3
LinkDB
Position
7:complement(18873790..18876133)
AA seq 405 aa
MAPVPATAAAAAPAAVVSTHEIRRAQRADGPATVLAIGTANPETCVPQDEYADFYFRVTK
SEHLPELKNKLRRICNKSGIEKRFMFVNDDVMEAHPEFADRHLTSLDARVEIVSKVVPEL
AAAASAKAIAEWGRPATDITHLIFSTYSGVKAPGGDRLLASLLGLRPTVSRTVLSLHGCY
GGGRALQLAKELAENNRGARVLVACAESTLIAFYGPEVGCNDTIIGQALFGDGSGAVIVG
ADPVGAVERPLFEMAFASQATVPDSEGAITMQHKKGGMDYHIGGGVPEMLAGSIERCLAD
AFGAIGVAARWRDLFWAVHPGGRRILDLIEEALGLDNGAMAASRQVLREYGNMSGTTVIF
VLNELRRRFVADGAEGADWGALMAFGPGVTVETILLRVGSGLKGN
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcacctgttccggccaccgccgccgccgccgcccctgcggccgtcgtcagcacccac
gagatccggcgtgcgcagcgcgccgatggcccggccaccgtgctcgccatcggcacggcg
aacccggagacgtgcgtgccgcaggatgagtacgccgacttctacttccgcgtcaccaag
agcgagcacctgcctgagctcaagaacaagctcaggagaatctgtaacaagtcaggcatc
gagaagcggttcatgttcgtgaacgacgacgtcatggaggcacacccggagttcgccgac
cgacacctgacgtcactcgacgccagggtggagatcgtctccaaggtcgtgccggagctc
gccgcggccgcctcggcgaaggcgatcgccgagtggggccggccggccaccgacatcacc
cacctcatcttcagcacctactccggcgtcaaggcgcccggcggcgaccgcctgctggcg
tcgctcctcggcctccgccccaccgtgtcgcgcaccgtgctcagcctccacggctgctac
ggcggcggccgggcgctgcagctcgccaaggagctcgccgagaacaaccgcggcgcgcgc
gtcctcgtcgcctgcgccgagtccacgctcatcgcgttctacgggcccgaggtggggtgc
aacgacaccatcatcgggcaggcgctgttcggcgacggctcgggcgccgtcatcgtcggc
gccgacccggtcggcgccgtcgagcgcccgctgttcgagatggcgttcgcgtcgcaggcc
accgtcccggacagcgagggcgccatcaccatgcagcacaagaagggcggcatggactac
cacatcggcggcggcgtgccggagatgctcgccggcagcatcgagcggtgcctggccgac
gcgttcggcgccatcggcgtcgccgccaggtggagggacctcttctgggccgtccacccg
ggtggccgaaggatcctggacctcatcgaggaggcgctcgggctggacaacggcgccatg
gcggcgagccggcaggtgctgcgcgagtacggcaacatgagcggcaccacggtgatcttc
gtgctcaacgagctgcgccgccggttcgtcgccgacggcgccgagggagccgactggggc
gcgctgatggcgttcgggccgggcgtcaccgttgagaccattttgctccgcgtcggaagc
ggcctcaagggaaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343430
Entry
4343430           CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4343430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    4343430
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     4343430
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    4343430
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III FAE1_CUT1_RppA ACP_syn_III_C
Other DBs
NCBI-GeneID: 4343430
NCBI-ProteinID: XP_015646364
UniProt: Q0D5Y1
LinkDB
Position
7:complement(20419873..20421582)
AA seq 398 aa
MATTSHVTVHDIRRAQRADTTAAVLAIGTANPVTCISQADYPDYYFRITNTEHLTDLKRK
LNNLCQASGADKRFFHHNEEMIAAHPEFLDRATPSLDARLDIAAAAGPELAAQAAERAIV
RWGRPAADITHLVVATNAGAQAPGADHRLASLLGLRPTVRRTMLHLSGCSAGAAALRLAK
DLAENSRGARVLVACVELNVVAFHGLKEDYPQTLTCQGLFGDGAGAVIVGADAVRPVERP
LFEMVAVSQAVIPGTEHALNMRLTEHGLDGHVSIKDLIPLAAANADELLSDAFRQLGLAG
VEWNDLFWVVHPGAPSILDQIESALRLEPGKLAASRKVLREYGNMLGSTLIFVLDEQRRR
MEEEEGGRSAEWGVMMGFGPGFTIETMVLHLPECPKEQ
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcaaccaccagccatgtcaccgtccacgacatccgtcgtgcgcagcgtgcagacacc
accgccgccgtgctggccatcggcaccgcgaacccggtcacctgcatctcccaagccgac
taccccgactactacttccgtatcaccaacacagagcacctcactgacctcaaacgcaaa
ctcaacaacctatgccaggcatcaggcgccgacaagcgtttcttccaccacaacgaggag
atgattgccgcgcacccggagttcctcgaccgcgccacgccgtcgctggacgcccggctg
gacatcgccgccgccgcggggccggagctcgcggcgcaggcggcggagagggccatcgtc
cggtggggccgccccgcggccgacatcacccacctcgtcgtggccaccaacgcgggcgcg
caggccccgggcgcggaccaccgcctcgcctcgctcctcggcctccgccccaccgtgcgc
cgcaccatgctccacctcagcggctgctccgcgggcgccgccgcgctgcgcctcgccaag
gacctcgccgagaacagccgcggcgcgcgcgtcctcgtcgcctgcgtcgagctcaacgtc
gtcgcgttccatggcctcaaggaggactacccccagacgctcacctgccagggactgttc
ggcgacggcgccggcgcggtcatcgtcggcgccgatgccgtgcgccccgtcgagcgcccg
ctcttcgagatggtcgccgtgtcgcaggccgtgatcccgggaacggagcacgccctcaac
atgcggctcacggagcacggcctcgacggccacgtctccatcaaggacctcatacctcta
gcggcggccaacgccgacgagctcctgtccgacgcgttccggcagctcggcctcgccggc
gtcgaatggaacgatctcttctgggtggtgcaccctggagccccgtcgatcttggaccaa
atcgagagcgctctccggctggagcccgggaagctggcggcgagccggaaggtgctaagg
gagtacggcaacatgctgggcagcacgctgatcttcgtgctcgacgagcagcggcggcgg
atggaggaggaagaaggcggtcgatcagctgagtggggggtgatgatggggtttggacct
ggtttcaccattgagaccatggtgttgcacttgcctgaatgccctaaagaacagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343431
Entry
4343431           CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4343431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    4343431
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     4343431
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    4343431
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III FAE1_CUT1_RppA ACP_syn_III_C
Other DBs
NCBI-GeneID: 4343431
NCBI-ProteinID: XP_015646172
UniProt: A0A5S6RA39 Q69UA9
LinkDB
Position
7:complement(20455476..20456898)
AA seq 398 aa
MGSLVAPVTVHEHRRAERADGPATVLAIGTANPANCVTQLDYADFYCRVTNSEHLAGIKD
KLDTLCVSASGSEKRFFHHTEEMINAHPEFLDRAKPSLDARLEIAAAAVPELAATAAARA
IVQWGRPATDITHLIVTTNAGAHAPGADVRFAALLGLRPTVRRTMIHLNGCSAGAAALRL
AKDLAENSRGARVLVSCVELTVLTFRGPDCPHTVNCQALFGDGAGAVIVGADAVRPVEQP
MFEMVSASQTLIPGTEHVITMQLTEHGLDGNIDAKELAPLAANNVKKCLSDALTPLGLDG
GEWNDLFWAVHPGSPLILDHIESALQLKPGKLAATRRVLREYGNMLGSTLIFVLDEQRRR
MEEEGDGAEWGVTLGFGPGFTIETMVLHAPDHDSRKKN
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgggcagcctcgttgctccggtcaccgtccacgagcaccggcgtgccgaacgagcagac
ggcccagccaccgtgctggccatcggcacggcgaacccagcgaactgcgtgacccagctc
gattacgccgacttctactgccgtgtcaccaacagcgagcacctcgctggcatcaaagac
aaattagacacactatgtgtgtcggcgtcgggcagtgagaagcgtttcttccaccacacg
gaggagatgatcaacgcgcaccctgaattcctcgaccgcgcgaagccgtcgctggacgcg
cgcctggagatcgccgccgccgccgtcccagagctcgccgcgacggccgcggcgagggcc
atcgtgcagtggggccgccccgccaccgacatcacccacctcatcgtgaccaccaacgcg
ggcgcccacgccccgggcgccgacgtccgcttcgccgcgctcctcggcctccgccccacc
gtgcgccgcaccatgatccacctcaacggctgctccgcgggcgccgccgcgctgcgcctc
gccaaggacctcgccgagaacagccgcggcgcgcgcgtcctcgtctcctgcgtcgagctc
accgtcctcaccttccgcgggccggactgcccccacaccgtcaactgccaggcgctgttc
ggcgacggcgccggcgcggtcatcgtcggcgccgacgccgtgcgccccgtcgagcagccg
atgttcgagatggtctcggcttcgcaaacgctcataccggggaccgagcacgtcatcacc
atgcagctcacggagcacggcctcgacggcaacatcgatgccaaagagctcgcccctctc
gccgcgaacaacgtcaagaagtgcctctccgacgcgctcacgccgctcggcctcgacggc
ggcgagtggaacgacctcttctgggcggtgcacccgggaagcccgttgatcttggaccac
atcgagagcgctctccagctaaagccggggaagctggcggcgacccggagggttctaagg
gagtacggcaacatgctcggcagcacgctgatcttcgtgctcgacgagcagcgacggcgg
atggaggaggaaggagacggagctgagtggggggtgacgctggggtttggacccggtttc
accattgagaccatggtgttgcacgcacctgatcatgacagccggaagaagaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343432
Entry
4343432           CDS       T01015                                 
Name
(RefSeq) bisdemethoxycurcumin synthase-like
  KO
K17212  bisdemethoxycurcumin synthase [EC:2.3.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4343432
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:osa01008]
    4343432
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.211  bisdemethoxycurcumin synthase
     4343432
Polyketide biosynthesis proteins [BR:osa01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    4343432
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III FAE1_CUT1_RppA ACP_syn_III_C
Other DBs
NCBI-GeneID: 4343432
NCBI-ProteinID: XP_015645417
UniProt: A0A0P0X6S2 Q6Z4M0
LinkDB
Position
7:complement(20504689..20506468)
AA seq 399 aa
MGSTPAAVPVTVDELRRAQRADGTAAVLAIGTANPANCVTQADYADLYCRVTNSEHVAGF
KDKLDALCVSASGSEKRFFHHTEEMINAHPEFLDRATPSLDARLEIAAAAVPELAATAAA
RAIVQWGRPATDITHLVVTTNAGAHAPGADVRLAALLGLRPTVRRTMIHLNGCSAGAAAL
RLAKDLAENSRGARVLVACVELTVLTFRGPYSPHTVTCQALFGDGAGAVIVGADAARPVE
HPLFEMVSASQTLIPGTEHVITMQLTEHGLDGDIDTKELVPLAANNVKQCLSDALTPLGL
DGGEWNDLFWAVHPGSPLILDHIESALQLKQGKLAASRKVLRENGNMLGSTLIFVLEEQR
RRMEEEGDGAEWGVMLGFGPGFTIETMVLHAPDDSRKKN
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggggagcactccggctgctgttccggtcaccgtcgacgagctccggcgtgcgcagcgc
gcagacggcaccgccgccgtgctggccatcggcacggcgaacccggcgaactgcgtgacc
caggccgactacgccgacttgtactgccgtgtcaccaacagcgagcacgttgctgggttc
aaagacaaattagacgcactatgcgtatcggcgtcgggcagtgagaagcgtttcttccac
cacaccgaggaaatgatcaacgcgcaccctgaattcctcgaccgcgcgacgccgtcgctg
gacgcgcgcctggagatcgccgccgcggccgtcccagagctcgccgcgacggccgcggcg
agggccatcgtccagtggggccgccccgccaccgacatcacccacctcgtcgtgaccacc
aacgcgggcgcccacgccccgggcgccgacgtccgcctcgccgcgctcctcggcctccgc
cccaccgtgcgccgcaccatgatccacctcaacggctgctccgcgggcgccgccgcgctg
cgcctcgccaaggacctcgccgagaacagccgcggcgcgcgcgtcctcgtcgcctgcgtc
gagctcaccgtcctcaccttccgcgggccttacagcccccacaccgtcacctgccaggcg
ctgttcggcgacggcgccggcgcggtcatcgtcggcgccgacgccgcgcgccccgtcgag
cacccgcttttcgagatggtctccgcctcgcagacgctcataccggggaccgagcacgtc
atcaccatgcagctcacggagcacggcctcgacggcgacatcgacaccaaagagctcgtc
cctctcgccgcgaacaacgtcaagcagtgcctctccgacgcgctcacgccgctcggcctc
gacggcggcgagtggaacgacctcttctgggcggtgcacccgggaagcccgttgatcttg
gaccacatcgagagcgctctccagctaaagcaggggaaactggcagcgagccgaaaggtg
ctaagggagaacggcaacatgctgggcagcacgctgatcttcgtgctggaggagcagcga
aggcggatggaggaggaaggagacggagccgagtggggggtgatgctgggatttggaccc
ggtttcaccattgagaccatggtgctccacgcacctgatgacagcaggaagaagaattag

DBGET integrated database retrieval system