KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276128
Entry
107276128         CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit alpha-like
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107276128
   04141 Protein processing in endoplasmic reticulum
    107276128
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107276128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    107276128
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   107276128
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 107276128
NCBI-ProteinID: XP_015630120
UniProt: A3ALM2 A0A0P0W238 Q6AV46
LinkDB
Position
3:complement(27702838..27705219)
AA seq 479 aa
MAGRSSSSFRLLDLVRPFMPLLPEVREPDGRRVPFRRKLACTAAALFAFLACSQLPLYGL
HRAAAAGGGADPFYWVRAILASNRGTVMELGITPVVTAGTLVQLLVGSNLVRADSSNPDD
RALLSAAQKLLSIVITAGEATAYVLSGAYGSVGVLGAGNAVLVVLQLVLGGMVAIFLDEL
LQKGYGFGSGISLFTAANTCEGVVTRALSPATMDRGRGAEFVGAVTAAAHLLATRARKLS
AVREAFFRGGGGGSLPDLRGLAATCAVFLAAVYLQGVRVALPVRPRNAPRSHRGGAYSVR
LLYTSGMPVVLLSSAVSSLYVVSQALYRRFGGSLLVDLLGKWTPDAAVPVGGIAYYVTAP
ASAASAAANPLHAAMYVAFVLAACAALSRAWVVVSGSSSRDVARRLREQQMVMPGMREAS
MQRELERYIPAAAALGGVCVGALTVAADLMGAVGSGAGMLLAVTTVYQCYEAFEKEKTY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcgggcaggtcgtcgtcgtcgttccggttgcttgacctggtccggccgttcatgccg
ctgctgccggaggtgcgggagcccgacggccggcgcgtcccgttccggcggaagctggcg
tgcacggcggcggcgctcttcgccttcctcgcctgcagccagctgccgctctacgggctc
cacagggcggcggcggccggcggcggcgccgacccgttctactgggtccgcgccatcctc
gcctccaaccgcggcaccgtcatggagctcggcatcacccccgtcgtcaccgccggcacc
ctcgtccagctcctcgtcggctccaacctcgtccgcgccgactcctccaatcccgacgac
cgcgccctcctgagcgcggcgcagaagttgctctcgatcgtgatcaccgccggcgaggcg
acggcgtacgtgctgtccggggcgtacgggagcgtcggcgtgctcggcgccggcaacgcc
gtgctcgtcgtgctgcagctcgtgctcggcggcatggtggccatcttcctcgacgagctc
ctccagaaggggtacgggttcggctccggcatctccctgttcaccgccgccaacacctgc
gagggcgtcgtcaccagggcgctcagcccggcgacgatggaccgcggccgcggcgccgag
ttcgtgggcgcggtcaccgccgcggcgcacctgctggcgaccagggccagaaagctgtcc
gcggtgcgcgaggccttcttccgcggcggcggcggcggcagcctccccgacctgcgcggc
ctggccgccacctgcgccgtcttcctcgccgccgtctacctccagggcgtgcgcgtggcg
ctgccggtgcggccgcggaacgcgccgcgcagccaccgcggcggcgcctacagcgtccgc
ctcctctacacctccggcatgcccgtcgtgctgctctcctcggcggtctcgtcgctctac
gtcgtctcccaggcgctgtaccgccggttcggcgggagcctcctcgtcgacctgctcggc
aagtggacgccggacgccgccgtccccgtcggcggcatcgcctactacgtgaccgcgccg
gcgagcgcggcgagcgcggcggcgaacccgctccacgcggcgatgtacgtggcgttcgtg
ctcgcggcgtgcgcggcgctgtccagggcgtgggtggtggtgtccgggtcgtcgtcccgg
gacgtggcgaggcggctccgggagcagcagatggtgatgccggggatgcgggaggcgagc
atgcagagggagctggagcggtacatcccggcggcggcggcgctcggcggcgtgtgcgtc
ggcgcgctgacggtggccgccgacctgatgggcgccgtcggctccggcgccgggatgctg
ctcgcggtgaccaccgtgtaccagtgctacgaggccttcgagaaggagaaaacctattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276600
Entry
107276600         CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit alpha-like 1
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107276600
   04141 Protein processing in endoplasmic reticulum
    107276600
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107276600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    107276600
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   107276600
SSDB
Motif
Pfam: SecY
Other DBs
NCBI-GeneID: 107276600
NCBI-ProteinID: XP_015619325
LinkDB
Position
12:complement(25916295..25919945)
AA seq 413 aa
MQRRREAAVPFRGQVRNTAAASLLLLLSLSHVPLYAGAGDADPDPLFWARPLLAAPRGTV
MELGVAPVVTSWVVVRLLAALLFDSDSSTTVASCENASRLVIGIAAALGMCGSGGAGNAA
LVVLQLFAGGVVVVLADLLHETGYGVEGVSAASLLIATNACERAVSHLFSPVKLRLAGAG
PEFEGPVFAVTHRVAAAPPSWRHKAGALLFTLLRLDLPNLSNYMTTCVMFVLAVRLDETH
LRRLYRSRPRRGTDDSGGGGGGFVVNLLGRWKDAGGGAAYPVGGLVYYVTPPSKLLVDPG
LIHELLIHSVFVVASCTLLSMAWAEASRSSAREFRTRVIGTGYFVWDETSRRIDRVIAAA
AAVGGFAVGGLAVYAGAVGAIGEAGPELLFAVLVIKNLAETFYAKSKLTTTYS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcagaggaggagggaagcggcggtgccgttccgcggccaggtgcggaacacggcggcg
gcgtcgctgctgctcctgctctcgctgagccacgtcccgctctacgccggcgccggcgac
gccgaccccgacccgctgttctgggcgcggcccctcctcgccgcgccccgcggcacagtg
atggagctcggcgtcgcccccgtcgtcacgtcgtgggtggtggtgcgcctcctcgccgcc
ctcctcttcgactccgactcctcaaccaccgtggcctcctgtgagaacgcgtcgcggttg
gtgatcgggatcgcggcggcgcttgggatgtgcgggagcggcggagcgggcaacgcggcg
ctcgtcgtgctccagctcttcgccggcggcgtggtcgtcgtgctggccgacctcctccac
gagacgggctacggcgtggagggcgtctccgccgcctccttgctcatcgccaccaacgcc
tgcgagcgcgcggtgtcgcacctgttcagccccgtgaagctccgcctcgccggcgccggc
ccggagttcgaggggcccgtgttcgccgtcacccaccgcgtggccgccgcgccgccgtcg
tggcggcacaaggccggggcgctcctcttcacgctgctccgcctggacctccccaacctc
tccaactacatgaccacctgcgttatgttcgtcctcgccgtgcgcctcgacgagacccac
ctccggcggctgtaccgctccagaccgcgccgcggcaccgacgacagcggcggcggcggc
ggcggtttcgtcgtcaacctgctcggcaggtggaaggacgccggcggcggcgccgcctac
ccggtgggcggcctcgtctactacgtcacgccgccgtcgaagctgctggtggatcccggc
ctgatccacgagctgctgatccatagcgtgttcgtcgtcgcgtcgtgcacgctcctctcc
atggcctgggccgaggcgtcgcgctcgtcggcgagggagttcaggacgcgggtgatcgga
acgggatacttcgtgtgggacgagactagccgtcggatcgaccgtgtcatcgcggcggcc
gccgccgtcggtggcttcgccgtcggtgggctcgccgtctacgccggcgccgttggagct
attggagaagctggtcctgaacttttgttcgcagttttagtcatcaagaacctggccgaa
accttctacgctaaatccaagcttactactacctatagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332042
Entry
4332042           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit alpha
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4332042
   04141 Protein processing in endoplasmic reticulum
    4332042
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4332042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4332042
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4332042
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 4332042
NCBI-ProteinID: XP_015632110
UniProt: Q10Q18 Q0DU15
LinkDB
Position
3:5896017..5899415
AA seq 475 aa
MAGGFRVLHLVRPFLAFLPEVQSADRKIPFREKVIYTVISLFIFLVCSQLPLYGIHSTTG
ADPFYWMRVILASNRGTVMELGITPIVTSGMVMQLLVGSKIIEVDNSVREDRALLNGAQK
LLGILIAIGEAVAYVLSGMYGSVSQLGTGNAILIILQLFFAGIIVICLDELLQKGYGLGS
GISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRTDKVRALREAFYRQ
NLPNVTNLLATVLVFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILHSAL
ITNLYFISQLLYRRYSGNFLVNLIGKWKESEYSGHSVPVGGLAYYVTAPSSLADVLANPF
HALFYVVFMLSACALFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPT
AAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERATELGFFGF
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctggtggctttagggtattgcatcttgtcaggccttttctggctttcctgcctgaa
gtacagagtgctgataggaaaataccatttagagaaaaagtgatctacactgttatttcc
ctattcattttcctggtatgcagccagctaccactgtatggcatccattcaactactgga
gctgatcctttctactggatgcgtgttatccttgcatcaaaccgtggtactgttatggag
ctgggtatcactccaattgtgacatctggcatggtaatgcaacttctagtgggatcaaag
atcattgaagttgacaacagtgtgagagaggatcgtgctctgctgaatggcgcacaaaag
ttacttggtatcctgattgcaattggggaagctgtggcatatgttttgtctggaatgtat
ggcagtgtaagccagcttggaactggaaatgccatcctcattatacttcagcttttcttt
gctggcatcattgtcatctgtctggatgaacttctccagaaaggttatggtttgggttct
ggcatttctctctttattgctaccaatatctgtgagaatatcatctggaaggcatttagc
cccacaactatcaacagtggccgtggtgctgagttcgagggggctgtcattgcattgttc
catctgttgattactagaaccgacaaagtccgtgccttgcgcgaggctttctaccgccag
aatcttccaaatgtgaccaacttgcttgctactgttttagtcttcctcatagttatctac
ttccaaggcttccgtgttgtgctaccagtgagatccaagaatgcccgcggtcaacaaggc
tcatacccaattaagctgttctacacttcaaacatgcccatcattctgcattctgcactg
attaccaacctctatttcatatcccagcttctctacaggaggtacagtggaaatttccta
gtcaaccttattgggaaatggaaggaatctgagtactctggccattctgttcctgttggt
ggtcttgcttactatgtaactgctccatcaagtttagctgatgttctcgcaaatccattc
catgcactgttctatgtggtcttcatgctgtcagcttgtgctctcttctcaaagacatgg
attgaagtatctggttcatcagcaaaggatgttgctaaacagctcaaggagcaacaaatg
gtgatgccaggccatcgtgagtcgaatttacagaaagaattgaacagatacatccctaca
gctgctgcatttggtggagtctgcattggtgcattgactgtcctagctgatttcatgggt
gcaattggttcaggaactgggatactgctcgctgttacaatcatctaccagtattttgag
acattcgagaaagaaagggctaccgagctaggtttctttgggttttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345097
Entry
4345097           CDS       T01015                                 
Name
(RefSeq) preprotein translocase subunit SECY, chloroplastic
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4345097
   04141 Protein processing in endoplasmic reticulum
    4345097
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4345097
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4345097
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4345097
SSDB
Motif
Pfam: SecY TssN
Other DBs
NCBI-GeneID: 4345097
NCBI-ProteinID: XP_015650895
UniProt: Q6ZG25
LinkDB
Position
8:9405676..9414822
AA seq 556 aa
MAAMATPQQCWLPTRARAPPPPPPRAPSSASPVSGAPASLRFRGRRAASASASAARRRRG
ASLPCSPRCALETAGPGFDPLGLYNDGPSRNDTQSPLSNFFGVLSPVFGSSSGGRKEKSY
GRGAAAAIEDSSIDIGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNRDAFAGNLDQN
SLLGTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQLYPKLQDLQKKEGEAGRKKVL
QYTRYASVGFAIVQAIGQVLFLRPYVNDFSTEWVLTSVTLLTLGSVFTTFIGERISDLKL
GNGTSLLIFTSIISYLPASFGRTVAQAFQDGNYVGLLTIILSFLFLVLGIVYVQEAERKI
PLNYASRYSSRSGGLQRSAYLPFKVNSSGVMPIIFSTSSLALPGTLARFTGLEFLKKAAI
SLNPGGALYIPTNVLLIAFFNYYYTFLQLDPDDLSEQLKRQGASIPLVRPGKSTAAFIKT
VLSNISVLGSAFLAVLAAGPSVVEQITHLTAFRGFAGTSVLILVGCATDTARKVQAEIIS
QKYKNIEFYDVNRFDQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggcggccatggccaccccgcagcaatgctggctccccacccgcgcgcgcgctccccct
cctcctcctccacgcgcaccctcctccgcgtcccccgtctccggagctcccgcctccctc
cgcttccgtgggcgccgcgccgcgtcggcgtcggcgtcggcggcgaggaggaggagggga
gcctccctgccctgctcccccaggtgcgcgttggagacggctggccctggctttgatccc
ctagggctgtacaacgatgggccttcgaggaatgacacgcagtccccgctgtcgaacttc
ttcggagtactgtcgccggtgttcgggagctcgagcggcggcaggaaggagaagtcctat
ggacgaggagcagcagctgcaattgaagatagttccattgacattggtgacttcttcaag
ggtcctctacctgggaagttcttgaagctccttggttatttggccttgtctcgacttggt
atttatatacctctgggtggagtgaaccgggatgctttcgctggtaatcttgaccagaac
agtctactaggcactttggattctttttctggtggaggtattggccgacttggaatatgc
tcccttggcattgttccatttatcaatgcacagattgtgtttcagcttcttgcacaactt
tatcccaaattgcaagatcttcagaaaaaagaaggagaggcaggaagaaagaaggttctt
cagtatacaagatacgcatctgttggttttgcaattgtccaggctattgggcaagttctt
tttcttcgtccttatgttaatgacttcagcacagaatgggtcctcacatctgtgacacta
ctgacgcttggatcggtgtttacaactttcattggcgaaagaatatctgatttaaaactc
ggaaatggaacatctcttcttatatttacaagtataatatcgtatttacctgcatcgttt
ggaaggacagttgcacaggcatttcaagatgggaattatgttgggcttctgacaatcata
ttatcgttccttttcttagttcttgggattgtttatgtccaagaagccgagaggaaaatt
ccgctaaattatgcttctcgatacagtagtcggagtggagggctccaacgatctgcatat
ctaccatttaaggtcaatagttctggtgtcatgcctataatattttctacatcttctttg
gctttgcctggtactttggcacgatttactggcttagagtttcttaaaaaggctgccata
tccctaaatccaggaggtgctttgtatattccaactaatgtactgcttatagcctttttc
aattactattacaccttccttcaattggatcctgatgatcttagtgagcaattgaagcgg
caaggtgcttcaataccgcttgtacggccagggaaaagtacagctgccttcataaaaaca
gttcttagtaatatatctgtcctaggatctgccttccttgctgttttagctgctggacca
tctgtggttgaacaaatcactcacttaacggcatttcggggatttgctggtacatcagtg
cttatccttgttggatgtgcaacagacacagctcggaaagttcaggcagaaataatttca
cagaaatataagaacattgagttctatgatgtcaaccgttttgaccaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346809
Entry
4346809           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit alpha
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4346809
   04141 Protein processing in endoplasmic reticulum
    4346809
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4346809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4346809
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4346809
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 4346809
NCBI-ProteinID: XP_015612260
UniProt: Q6ES89 Q6ES11
LinkDB
Position
9:complement(10905715..10909826)
AA seq 475 aa
MAGGFRVLHLVRPFLAFLPEVQSADRKIPFREKVIYTVISLFIFLVCSQLPLYGIHSTTG
ADPFYWMRVILASNRGTVMELGITPIVTSGMVMQLLVGSKIIEVDNSVREDRALLNGAQK
LLGILIAIGEAVAYVLSGMYGSVSQLGTGNAILIILQLFFAGIIVICLDELLQKGYGLGS
GISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRTDKVRALREAFYRQ
NLPNVTNLLATVLVFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILHSAL
ITNLYFISQLLYRRYSGNFLVNLLGKWKESEYSGHSVPVGGLAYYVTAPSSLADVLANPF
HALFYVVFMLSACALFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPT
AAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERATELGFFGF
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctggtggttttcgagtactgcatcttgtcaggccctttctggctttcctgccagaa
gtacagagtgctgataggaaaataccattcagagaaaaagtgatctataccgttatctct
ctcttcattttcctggtgtgcagtcagctcccactctatggaattcattcaactactgga
gcagatcctttctactggatgcgtgttattcttgcatcaaaccgtggcactgttatggag
ctgggtattaccccaattgtgacatctggaatggtaatgcaacttctagtgggatcaaag
attattgaagttgacaacagtgtgagagaggaccgtgcacttctgaatggcgcacaaaag
ctgctgggtatcttgattgctattggggaagctgtggcatatgtgctgtctggaatgtat
ggtagtgtgagccaacttggaactggcaatgccattctcatcatcctacaacttttcttt
gctggcatcattgttatctgccttgatgaacttctccagaaaggctatggtttgggttct
ggcatttctctgttcattgctaccaatatctgtgagaatatcatctggaaggcgtttagc
cccacaaccatcaacagtgggcgtggtgctgaatttgaaggagctgtcattgcattgttc
catttgttgattactagaactgacaaagtccgtgccttgcgtgaagctttctaccgtcag
aaccttccgaatgtgacaaatttacttgcaactgtattggtcttcctcatagtcatctac
ttccaaggcttccgtgttgtgcttccagtgagatcaaagaatgctagggggcagcaaggc
tcatatccaattaagttgttctacacttcaaacatgcccatcattctgcactctgcactg
attaccaacctctacttcatatcacagcttctctacaggaggtacagtggaaattttctg
gttaaccttcttgggaaatggaaggaatctgagtactctggccattcggttcctgttggt
ggtctcgcttactatgtaactgctccatcaagtttggctgatgttcttgcaaatccgttc
catgcgttgttctatgtggtcttcatgctgtcagcttgtgctctcttctcaaagacatgg
attgaagtatctggctcatctgcaaaggatgttgctaaacagctgaaggaacagcaaatg
gtgatgcctggccatcgtgagtcaaacttgcagaaggaattgaacagatacatccccact
gccgctgcatttggtggagtgtgcattggtgcattgactgttctagctgatttcatgggt
gctattggttcaggaactggtattctgcttgctgttactatcatctaccagtacttcgag
acattcgagaaagagagggcaactgagcttggtttctttggtttttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346811
Entry
4346811           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit alpha
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4346811
   04141 Protein processing in endoplasmic reticulum
    4346811
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4346811
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4346811
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4346811
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 4346811
NCBI-ProteinID: XP_015612323
UniProt: Q6ES89 Q6ES11
LinkDB
Position
9:complement(10915274..10919400)
AA seq 475 aa
MAGGFRVLHLVRPFLAFLPEVQSADRKIPFREKVIYTVISLFIFLVCSQLPLYGIHSTTG
ADPFYWMRVILASNRGTVMELGITPIVTSGMVMQLLVGSKIIEVDNSVREDRALLNGAQK
LLGILIAIGEAVAYVLSGMYGSVSQLGTGNAILIILQLFFAGIIVICLDELLQKGYGLGS
GISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRTDKVRALREAFYRQ
NLPNVTNLLATVLVFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILHSAL
ITNLYFISQLLYRRYSGNFLVNLLGKWKESEYSGHSVPVGGLAYYVTAPSSLADVLANPF
HALFYVVFMLSACALFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPT
AAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERATELGFFGF
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctggcggttttcgagtactgcatcttgtcaggccctttctggctttcttgccagaa
gtacagagcgctgataggaaaataccattcagagaaaaagtgatctataccgttatctct
ctcttcattttcctggtgtgcagtcagctaccactctatggaattcactcaactactgga
gcagatcctttctactggatgcgtgttattcttgcttcaaaccgtggtactgttatggag
ctgggtattaccccaattgtgacatctggaatggtaatgcaacttctagtgggatcaaag
attattgaagttgacaacagtgtgagagaggaccgtgcacttctgaatggcgcacaaaaa
ttgctgggcatcttgattgctattggggaagctgtggcatatgtgctgtctggaatgtat
ggcagtgtaagccaacttggaactgggaatgccattctcatcatcctccagcttttcttt
gctggcatcattgtcatctgtcttgatgaacttctccagaaaggctatggtttgggttct
ggcatttcattgtttattgctaccaatatctgtgagaatatcatctggaaggcgtttagc
cccacaaccatcaacagtgggcgtggtgctgaatttgaaggagctgtcattgcattgttc
catttgttgattactagaactgacaaagtccgtgccttgcgtgaagctttctaccgtcag
aaccttccgaatgtgacaaatttacttgcaactgtattggtcttcctcatagtcatctac
ttccaaggcttccgtgttgtgcttccagtgagatcaaagaatgctagggggcagcaaggc
tcatatccaattaagttgttctacacttcaaacatgcccatcattctgcactctgcactg
attaccaacctctacttcatatcacagcttctctacaggaggtacagtggaaattttctg
gttaaccttcttgggaaatggaaggaatctgagtactctggccattcggttcctgttggt
ggtctcgcttactatgtaactgctccatcaagtttggctgatgttcttgcgaatccgttc
catgcgctgttctatgtggtattcatgctgtcagcttgtgctctcttctcaaagacatgg
attgaagtatctggctcatctgcaaaggatgttgctaaacagttgaaggaacaacaaatg
gtgatgcctggccatcgtgagtcaaacttgcagaaggaattgaacagatacatccccact
gctgctgcatttggtggagtgtgcattggtgcattgactgttctagctgatttcatgggt
gcgattggttcaggaactggtattctgcttgctgttaccatcatttaccagtacttcgag
acattcgagaaagagagggcaaccgagcttggtttctttggtttttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347548
Entry
4347548           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit alpha isoform 2
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4347548
   04141 Protein processing in endoplasmic reticulum
    4347548
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4347548
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4347548
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4347548
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 4347548
NCBI-ProteinID: XP_015612394
UniProt: A0A0P0XP58
LinkDB
Position
9:19917347..19920311
AA seq 466 aa
MSNRSKFWRLAALVPEVQCPDQPISPRQKFKYTAIVLFIFVTASQVLLYGIQHQPRTIEP
DPLHWLHLILASSRSTLLSHGIVAILVPEVLVKIWVYLKIITLDTSAPETGVLMNRAQRL
LGILVAILGAVNFYVRSQHFTVNTVLIMLQILCSDIIVIYLDDVLRKGYGLLSGISLFTA
TNICVNILWKAFSPMSVMYPEQSPEFEGAVIAWVHLLMTRTDKLSAMSKAFYRQNLPNII
NFLATCLFVPLAIFFQGFYIVLPVRTRRNFQAYCHIKLSHFLYGPVVLHRLLLPLPYVAS
KVLYKKYSGNTLVNLLGKWDGLNHFGQSIPVGGIVYYLRTPPILADLHRDPFHAFIYVAF
VLISCVFISMGLMVCASSKGVFNGFVVLNMQEERRLRLAQPDSIHANEIRRHVMRAACVG
GFCAGVLIIFADLIGVFCSGTGIMLAVTASYPYVDGRASEVGSFGF
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgtcaaataggtcaaagttctggagattagcagcgctagtccctgaagtgcagtgtcct
gaccagcccatctctccccgtcaaaaatttaaatacacggccattgtacttttcatcttt
gtgactgccagccaagttctattgtatgggatccaacaccaacctcgaaccattgagcct
gatccattacattggctgcatctgattctggcgtcaagccgtagtactctcttgtcgcac
gggatcgtcgctattctagtacctgaggttctggtgaagatctgggtgtacctaaagatc
ataactctcgataccagtgcacctgaaactggtgttcttatgaatagagcacaaaggttg
ctggggatattggttgccattctgggagctgttaatttctatgtgcgaagccaacatttc
actgtcaatacggttctaataatgcttcagattctttgctctgatatcattgtcatttat
cttgatgatgtcctaagaaaaggatatggattgttatctggtatatccttgttcactgcc
accaacatctgtgtaaatattctgtggaaggccttcagccccatgtccgtcatgtatcct
gaacaaagccctgaatttgagggagctgttattgcctgggttcatcttctgatgactaga
acggataaattgtctgcaatgtctaaagccttttaccgtcaaaacctcccgaatattatc
aattttctagccacttgcttgtttgttccacttgccatattcttccaaggcttctatatt
gtactgcctgtcaggacacggcgtaattttcaagcctactgccacatcaagctctcacat
ttcttgtatgggcctgttgtcttgcaccgtttactgctcccacttccttatgttgcctca
aaggtgctgtacaagaaatacagtggaaacacactagtgaatttgcttggcaagtgggat
ggattgaaccattttggacagtctatccctgttggagggatagtgtactacctaagaacg
ccccctatcttggctgatttgcacagggacccgttccatgcatttatatatgtcgcattc
gtgcttatttcatgtgtgtttatctcaatgggtcttatggtctgtgcatcttcaaaagga
gttttcaacgggtttgttgtgttaaatatgcaggaggaacgaagactgaggcttgcccag
cccgactcaatacatgcgaacgaaattcggcgtcatgtcatgagggcagcttgtgttggt
ggtttctgtgccggtgtactaataattttcgcagatctcattggggtgttttgttctggg
actggaattatgcttgctgtgactgcttcatatccttatgttgatggcagagctagtgag
gtcgggtcctttggcttctga

DBGET integrated database retrieval system