KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276130
Entry
107276130         CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: DExH-box ATP-dependent RNA helicase DExH12-like
  KO
K12854  pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107276130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    107276130
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107276130
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    107276130
 Complex C
   U5 SnRNP specific factors
    107276130
SSDB
Motif
Pfam: Sec63 DEAD Helicase_PWI ResIII AAA_22 AAA_30 Helicase_C AAA_25 AAA_11
Other DBs
NCBI-GeneID: 107276130
NCBI-ProteinID: XP_015631545
LinkDB
Position
3:30522780..30531379
AA seq 2168 aa
MAKPGSGGGAEAHARSRKYDYVENSNLVLGSGSGSRPRGGADEHTGEPETLRGRIDPRSF
GDRAVQAKPPVEPPRRRKARDAADHDIGHRLDAKRRRRAASACTAQREVSVLTLIDDVVY
RPRTKETRAAYEALLSVIQRQLGGQPPDVLGSAADEVLAILNNDKIKSPEKKRGIDKFLD
PISDQMFHQFVSIGKLITDFHDTAVCDSASELDENFGVAVEFEQNEDDEGSDSDQVLDDL
DEDDGDTMLNAAGAMQIGDELDDDDMHNSNEELAINAQDIDAYWLQRKVSQAYEDIDPQV
SQELSLEIMSFLSESDDKDVENRLVTLLGYDNFDFIKLLVRNRLKIFWCTCLARAEGQEK
RKMIEENMLSDPTLSPILEQLHATRVSAKDRLKNMEKSIRDEAKRLTEKQNAGINGARDQ
RVVKRDMESGWLKGQKQLLDLENLTFHQGGLLMVNKKCELPPGSFRTPHNGYEEVHVPAL
KAKPYENGEKVVKISDMPDWAQPAFAGMTQLNRIQSKVYDTALFKPDNIILCAPTGAGKT
NVAVLTILQQIGLHMKDGEFDNTKYKIVYVAPMKALVAEVVGNLSARLKEYNITVRELSG
DQNLTKQQIDETQIIVTTPEKWDIVTRKSGDRIYTQMVKLLIIDEIHLLHDNRGPVLESI
VXRSVRQTETTKEHIRLVGLSATLPNYQDVAVFLRVHSGGLFHFDNSYRPCPLAQQYIGI
TVKKPFQRFQLMNQICYEKVMAAAGKHQVLIFVHSRKETAKTARAIKDIALSNNKLTCFP
KVESASLEILADHANHVKSNDLKDLLPYGFGIHHAGLTRVDRELIEGLFADKHLQALVST
ATLAWGVNLPAHTVIIKGTQVYNPEKGAWTELSPLDVMQMLGRAGRPQYDTHGEGIILTE
QSELQYYLSLMNQQLPIESQFISRLADHLNAEIVLGTIQNVREACTWLGYTYLYIRMLRN
PTLYGLPADIMETDNTLDERRVDLVHAAANILDWNNLIKYDRKTGYFQVTDLGRIASYYY
VSHRTISTYNECLKPTMGDIELCRLFSLSEEFKYVSVRQDEKMELAKLFNCVPIPVKESL
DEPSAKINVLLQAYISRLELEGLSLSSDMVYIRQNAGRLLRALFEIVLKRGWAQLAEKAL
NLCKMIDKHIWNVQIPLHQFPSIPKEILMKLEKKELAWERYFDLSSQEIGELIRNPKMGM
QLHKCIHQLPKLNLSAHVQPITPTVLGFELTITADFQWDDELHGYVEPFWLIVEDNGGDN
ILHHEYFMLKKQYVDEDHTLNFTVPIYEPLPPQYFIRVVSDKWLGSQTILPVSFRHLTLP
EKYAPPTELIDLQPLPVTALRNARYESLYCAFKHFNPIQTQVFTASYNSDDSVLVAAPTG
SGKTICAEFAILRNHQKAVSGDSNMRVVYVAPIEALAKERYKDWESKFGELARVVELTGE
TAADLKLLDKGEIIISTAEKWDALSRRWKQRKNVQQVSLFIFDELHLIGSENGHILEIII
SRMRHMANHIGSNIRIVALSASLANGKDLGEWIGTSSHSLFNFPPAVRPLPLEIHIQGWD
VAIFEARMQAMSKPTYTAITQHAKHGKPALVFVPTHKHARLTAVDLCAHSSAESGGTPFL
LGSEDEMDTFTSGVNDEALKYTLKCGVGYLHEGLSDFDQELVTQLFLGGRIQVCVASSKM
CWGRSLPSHLVVVMGTQYYDGRGNSHTDYPVTDLLQMMGHANRPLQDDSGKCVILCYAPR
KEYYKKFLFEAFPVESHLQHFLHDHMNAEVVAGLIENKQDAVDYLTWTFMYRRLAKNPNY
YNLQDVSHRHVSEHLSELVETVLNDLESTNCLAIEENIYLKTLNLGLIASYYYVTYTTIE
RFSSMLTQKTKLKGLLEILASASEYADLPSRPGEQKSIERLVHHQRFSVEKKVRYDDPHV
KANALLQCHFSRRTVEGDLAADQREILLPAHRLLQALIDVISSNGWLTLALNAMELSQMV
TQGMWDRDSVLLQLPHFTEELARRCQENEGKAIETIFDLAEMSTHEMQDLLQLPSSQLQD
IVGFLRRFPNIDMAFQVLEGDGGSVTVQVTLEREMADLLQSEAGPVHAPRFPKPKEEGWW
LVIGDRSTDQLLAIKRVKLQKRARVKLEFAAPAEAGRKDYMVYLMSDSYLGCDQEYEFAV
DVKDAGGD
NT seq 6507 nt   +upstreamnt  +downstreamnt
atggccaagccgggtagcggcggtggcgccgaggcgcacgcgcgttcgaggaagtacgac
tacgtcgagaactcgaacctcgtgctcggctccggctccggctcgcgcccccgtggcggc
gcggacgagcacaccggcgagcccgagacgctccggggcaggatcgacccgaggagcttc
ggcgaccgcgccgtccaggccaagccccccgtcgagccgccgcgcaggaggaaggcgcgc
gacgccgcggaccacgacatcggccaccgcctcgacgccaagcgcaggcgccgcgccgcc
tccgcctgtaccgcgcagcgcgaggtcagcgtgctcacgctcatcgacgacgtcgtgtac
aggccccggaccaaggagacgcgagccgcctacgaggccctgctcagcgtcatccagcgg
cagctcggcggccagcctcctgacgtgcttggcagcgccgccgacgaggtgcttgccatc
ctcaacaatgacaagatcaagagccctgagaagaagagggggatcgacaagttcctcgac
cccatctccgaccagatgttccaccagttcgtctccatcggtaagctcatcacagatttt
catgatactgcagtttgtgattcagctagtgaactggatgaaaatttcggcgttgctgtt
gagtttgaacagaacgaagacgatgagggaagtgattctgatcaggtactagatgatttg
gatgaggacgacggcgacaccatgctgaatgctgctggtgccatgcaaattggtgatgag
ttagacgatgatgatatgcataactccaatgaggagctggccataaacgcacaagacatt
gatgcttactggcttcagaggaaggtatcacaggcatatgaagatattgatccgcaggtt
agccaggagctttctttggagatcatgagttttctttctgagagtgacgacaaggatgtt
gagaatcggcttgtcacgctattgggctatgacaattttgatttcatcaaattgctggtg
cggaaccgactcaagatattctggtgtacttgtttggcaagggctgaaggtcaggaaaag
cggaagatgatagaagagaatatgctgagtgacccaacattaagtccaatattggagcag
ctgcatgcaacgagggtgtctgcaaaagataggctgaagaatatggagaaaagcatcagg
gatgaggccaagaggcttaccgaaaaacaaaatgctggcattaatggtgcgagggatcaa
agggtagttaagcgggatatggagagtggatggttgaaaggccagaagcagctgcttgat
cttgagaacctaaccttccaccaaggtggtctcttgatggttaacaagaaatgtgaactt
ccaccaggatcatttagaacccctcataacgggtatgaggaagtccatgtgccagcactg
aaagctaagccatatgaaaatggagagaaggttgtcaagatatctgatatgccagactgg
gctcaaccagcttttgctgggatgacacagctgaataggattcaaagcaaggtttatgat
actgcccttttcaaaccagataatattattctctgtgcaccaacaggtgctgggaaaacc
aacgtggctgtgcttacaatccttcagcagattggcttgcacatgaaagatggagagttt
gacaataccaaatacaaaattgtgtatgtagccccaatgaaagctttggttgctgaagtt
gttggaaatttgtcagcacggctgaaagagtacaatatcactgtaagggaactcagtgga
gaccagaacttaaccaaacaacagattgatgaaacacagattattgtcactacacctgag
aaatgggatattgtcacaagaaaatcaggtgacagaatctatactcaaatggtgaagctt
ctaataattgatgagattcatctacttcatgacaacagagggcctgttctggagagcatt
gttnntagatcagtcaggcagactgaaacaaccaaggaacatatccgtctagttggtctc
tcagcaactcttccaaactatcaagatgttgcagttttcttgcgtgttcactctggtggt
ctcttccattttgataacagctaccgaccttgccctcttgctcaacaatacattgggatc
actgtgaagaagcccttccagaggtttcagttgatgaatcagatttgctatgagaaggtt
atggctgctgctggaaagcatcaagtgcttatatttgtgcactcgaggaaggagacagcc
aaaactgctcgtgccatcaaagatattgcattatctaataacaaactgacctgctttcca
aaggttgagagcgcgagcctagagattcttgccgatcatgcaaatcatgtgaaaagcaat
gatcttaaagatcttttgccgtatgggtttggtattcatcatgctgggttgacaagggta
gaccgtgagctcattgaggggctttttgctgataaacatttacaggcgctcgtttcgaca
gcgacccttgcatggggtgtcaatttgcctgcgcacactgtaataataaagggtacccag
gtttacaatccggaaaaaggtgcttggacagaactgagccctctggatgtcatgcagatg
cttggtcgcgcgggcagacctcagtatgatacacatggagagggaataatactaactgaa
caaagtgaattgcagtactacctgtctctgatgaatcagcaactgcctattgagagtcag
ttcatatccagattggctgatcatctgaatgctgagatcgttctggggactattcagaat
gttcgggaggcatgcacctggcttggctacacctacctctacatcaggatgctccggaat
ccaacgttgtacggtttaccagcagatattatggaaacagacaatactctagatgaaagg
agagttgacttggtacacgctgctgcaaatatactggattggaacaatttgataaagtat
gacaggaaaacaggatattttcaggtaactgacctgggaaggattgctagttattactat
gttagtcacaggactatctcaacatacaatgagtgcctgaagcctacaatgggtgatatt
gagctgtgtcgactcttttcactgagtgaagaatttaagtatgtcagtgttagacaggat
gagaaaatggagttggcaaagcttttcaattgtgtgcctattcctgtgaaagagagcttg
gacgagcccagtgcaaagatcaatgttctactgcaagcatatatttctaggctggaactg
gagggtctttcccttagttcagatatggtctacatcagacagaatgctggccgtctccta
cgagcgctgtttgagatagttttgaagagaggatgggcccaactagcggagaaagcgttg
aatctttgcaagatgattgataagcatatatggaacgtccaaattcccctgcaccagttt
ccaagtattccaaaggaaatcttaatgaaactggagaaaaaagaattggcttgggagagg
tactttgacctatcatcacaggaaattggtgagctaattcgtaacccgaagatggggatg
cagctgcacaagtgcatccaccaattaccaaagctgaacctttcagcccatgttcaacct
attactcctacggttttgggttttgaactgactataacagctgatttccaatgggatgat
gaattgcatggatatgtggagcccttctggcttattgttgaggacaacggtggcgataac
attcttcaccatgagtacttcatgcttaagaaacaatacgtggatgaagatcatacactt
aacttcacagtgccaatatatgagccactgccccctcagtactttatacgcgtagtatct
gataagtggcttggttctcagacaattcttcctgtcagttttaggcatttaactcttcca
gaaaaatatgctccaccaactgaattgattgatctgcagccactacctgttactgccctg
agaaatgcacgatatgaaagcctttactgtgcttttaaacatttcaaccccatccagact
caagtgttcactgcctcgtacaacagtgatgacagcgtgttggttgcggcgccaacaggc
agtggaaagaccatatgtgcagagtttgctattctaagaaaccatcagaaggctgtatct
ggtgacagcaacatgcgtgttgtgtatgtagctcctattgaagctcttgcaaaagaaaga
tataaggattgggagagcaaatttggagaattggcgcgggtagttgagctaacaggcgaa
acagcagctgatttgaagcttcttgataaaggggagattataatcagtactgctgagaag
tgggatgcactctcacgccgatggaaacagcgaaagaatgtgcaacaggtcagtttattt
atttttgacgagctccatctgattggatctgaaaatgggcatattctggaaatcatcatc
tctaggatgaggcatatggcgaatcatattggtagtaacattcggattgtagcgctttca
gcatcccttgcaaatggtaaagatcttggagaatggattggcacctcctctcatagcctt
ttcaacttccctccagcagtgcgaccactgccgttagaaattcacattcagggttgggat
gtagcaatttttgaggcaaggatgcaggcaatgtcaaagccaacatacactgctataacc
cagcatgcaaagcatggtaagcctgccctggtgtttgtaccaacacataagcatgcaagg
ttgaccgcagtggatttgtgtgcacactcaagtgctgagagtggtggaacacctttcctt
cttgggtcagaagacgagatggatactttcactagtggtgtcaatgatgaagcacttaaa
tacactctgaaatgtggtgtaggctacttgcatgagggcctgagcgacttcgatcaggaa
cttgtaactcagctctttcttggtgggaggatccaagtgtgtgttgcaagcagcaaaatg
tgctggggaagatcattgccctctcatctggttgttgtgatgggaacccagtattatgat
ggccgggggaacagccatactgattatccagtcactgatctgttgcaaatgatgggccat
gccaacaggcctcttcaagatgactctgggaaatgtgttatattgtgctatgcgcctcgc
aaggaatactacaagaagttcctttttgaggccttccctgttgagagccatctccagcac
ttcttgcatgatcatatgaatgccgaggtggtagctggtcttatagaaaacaagcaagat
gccgtggattatcttacttggaccttcatgtaccgacggcttgcgaagaaccctaactac
tacaatctgcaggatgtgagccacaggcatgtatcagaacatctctctgagctggttgag
acagtgctgaacgacctggaatcaaccaattgtttggctatcgaggaaaatatttacctg
aagaccctcaaccttggtctcattgcctcgtattactacgtcacctacacgactattgag
cgattcagttctatgctaactcagaagaccaagttgaaaggcctcctggagattctagct
tctgcctcagaatatgcagatctccccagtcgccctggtgagcaaaaatccattgagagg
cttgttcatcaccagagattttctgtcgagaagaaagtcaggtatgacgatccacatgtc
aaggccaacgcactgctgcaatgccatttctcaaggcgcacggtggaaggtgaccttgca
gctgaccagcgggagattctccttcctgctcatagattgctccaggcactgatcgatgtc
atctccagcaacggatggctcaccctcgctctcaacgcaatggagctgagccagatggtg
acacagggcatgtgggatcgcgattccgtgctgcttcagcttccacacttcaccgaggag
ttagcccggagatgccaggagaacgaaggcaaggccatcgagaccatcttcgatctggct
gagatgagcacgcatgagatgcaggatctgctgcagctaccaagctcccagctgcaggac
atcgtcggattcctcaggcggttcccaaacatcgacatggctttccaagttcttgaaggc
gatggtggcagtgtgaccgtgcaggtgacgctagagcgcgagatggcagacctgctgcaa
tctgaggctggtccagtccatgcccccaggttcccaaagcccaaggaagaaggatggtgg
ctggtgattggtgatcgctccaccgaccagttgctggcaatcaagagggtcaagctccag
aagagggctcgagtgaagctcgagttcgctgcccctgcagaagcagggagaaaagattac
atggtttacttgatgtctgattcctatctgggctgcgaccaggagtacgagttcgccgtc
gatgtcaaggatgctggaggggattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328024
Entry
4328024           CDS       T01015                                 
Name
(RefSeq) DExH-box ATP-dependent RNA helicase DExH12
  KO
K12854  pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328024
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328024
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4328024
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4328024
 Complex C
   U5 SnRNP specific factors
    4328024
SSDB
Motif
Pfam: Sec63 DEAD Helicase_PWI ResIII Helicase_C AAA_22 AAA_30 AAA_25 AAA_11
Other DBs
NCBI-GeneID: 4328024
NCBI-ProteinID: XP_015625183
LinkDB
Position
2:410419..418493
AA seq 2177 aa
MANLGGGAEAHARFKQYEYRANSSLVLTTDSRPRDTHEPTGEPETLWGRIDPRSFGDRAV
QAKPPELEEKLTKSRKKKAAAADPDDLHRRDAKRRRRAAAAQREVSVLSLTDDVVYKPQT
KETRAAYEALLSVIQQQFGGQPLDVLGGAADEVLAVLKNDKIKSPDKKKEIEKLLNPISN
QMFDQIVSIGKLITDFHDASAGDSAAAPSGDGMDTALDDDIGVAVEFEENEDDEESDFDQ
VQDDLDEDEDDDLPESNAPGAMQMGGELDDDDMQNSNEGLTINVQDIDAYWLQRKVSQAY
EDIDPQHSQKLAEEILKIIAEGDDRDVENRLVMLLDYEKFDLIKLLLRNRLKIVWCTRLA
RAEDQEQRKKIEEDMMGNPTLTPILEQLHATRASAKERQKNLEKSIRDEAKRLTKSENTG
IDGARDRRAVDRDMESGWLKGQRQLLDLDSLSFHQGGLLMANKKCELPPGSFRTPHKGYE
EVHVPALKAKPYETGEKIVKISDMPEWAQPAFAKMTQLNRVQSKVYETALFKPDNILLCA
PTGAGKTNVAVLTILQQIGLHMKDGVFDNTKYKIVYVAPMKALVAEVVGNLSARLSAYGI
TVRELSGDQNLTKQQIDETQIIVTTPEKWDIVTRKSGDRTYTQMVKLLIIDEIHLLHDNR
GPVLESIVSRTVRQIETTKEHIRLVGLSATLPNYEDVAVFLRVRSDGLFHFDNSYRPCPL
AQQYIGITVRKPLQRFQLMNEICYEKVMASAGKHQVLIFVHSRKETAKTARAIRDTALAN
DTLNRFLKDDSASQEILGSQAELVKSSDLKDLLPYGFAIHHAGLARVDRELVEELFADKH
IQVLVSTATLAWGVNLPAHTVIIKGTQIYNPEKGAWTELSPLDVMQMLGRAGRPQYDTHG
EGIILTGHSELQYYLSLMNQQLPIESQFISRLADQLNAEIVLGTIQNAREACSWLGYTYL
YIRMLRNPTLYGLPADIMETDKTLDERRADLVHSAANLLDRNNLIKYDRKTGYFQVTDLG
RIASYYYISHGTISTYNEYLKPTMGDIELCRLFSLSEEFKYVSVRQDEKMELAKLLDRVP
IPVKESLEEPSAKINVLLQAYISRLKLEGLSLSSDMVYIRQSAGRLLRALFEIVLKRGWA
QLAEKALNLCKMIDKQMWNVQTPLRQFPGIPKEILMKLEKKELAWERYYDLSSQEIGELI
RFPKMGRQLHKCIHQLPKLNLSAHVQPITRTVLGFELTITPDFQWDDKVHGYVEPFWVIV
EDNDGENILHHEYFMVKKQYVDEDHTLNFTVPIYEPLPPQYFIRVVSDKWLGSQTILPVC
FRHLILPEKYAPPTELLDLQPLPVTALRNARYEGLYSAFKHFNPIQTQVFTVLYNTDDSV
LVAAPTGSGKTICAEFAILRNHQKAVSGESNMRVVYIAPIEALAKERYRDWEQKFGEFAR
VVELTGETAADLKLLDKGEIIISTPEKWDALSRRWKQRKQVQQVSLFIVDELHLIGSEKG
HVLEVIVSRMRRIASHIGSNIRIVALSASLANAKDLGEWIGATSHGLFNFPPAVRPVPLE
IHIQGVDIANFEARMQAMTKPTYTAITQHAKNGKPALVFVPTRKHARLTALDLCAYSSAE
GGGTPFLLGSEDEMDAFTGGISDETLKYTLKCGVGYLHEGLSDLEQEVVTQLFLGGRIQV
CVASSTVCWGRSLPAHLVVVMGTQYYDGRENAHTDYPITDLLQMMGHASRPLQDNSGKCV
ILCHAPRKEYYKKFLFEAFPVESHLHHFLHDHMNAEVVVGVIENKQDAVDYLTWTFMYRR
LTKNPNYYNLQGVSHRHLSDHLSELVETVLNDLESSKCVAIEEDMYLKPLNLGLIASYYY
ISYTTIERFSSMLTQKTKMKGLLEILASASEYAELPSRPGEEDFIEKLVRHQRFSIEKPK
YGDPHVKANALLQAHFSRHTILGNLAADQREILLSAHRLLQAMVDVISSNGWLTLALNAM
ELSQMVTQGMWDRDSVLLQLPHFTKELARRCQENEGRPIESIFDLAEMSIDEMRDLLQQS
NPQLQDIIEFFKRFPNVDMAYEVREGDDIRAGDNVTVQVTLERDMTNLPSEVGPVHAPRY
PKPKEEGWWLVIGDSSTNQLLAIKRVALQKRARVKLEFTAASEAGRKEYMIYLMSDSYLG
CDQEYEFTVDVMDAGGD
NT seq 6534 nt   +upstreamnt  +downstreamnt
atggcgaacctgggcggcggcgccgaggcgcacgcgcgcttcaagcagtacgagtaccgc
gccaactccagcctcgtcctcaccaccgactcgcgcccccgcgacacccacgagcccacc
ggcgagcccgagacgctctggggcaggatcgaccccaggagcttcggcgaccgcgccgtc
caggccaagccccccgagctcgaggagaagctcaccaagtcccgcaagaagaaggccgcc
gccgctgaccccgacgacctccaccgccgcgacgccaagcgcaggcgccgcgccgcagcc
gcccagcgtgaggtcagcgtcctctcgctcaccgacgacgtcgtctacaagccccagacc
aaggagacgcgcgccgcctacgaggccctgctcagcgtcatccagcagcagttcggcgga
cagccgctcgacgtgctcggcggcgctgccgacgaggtgctcgccgtcctcaagaatgac
aagatcaagagccctgacaagaagaaggagatcgagaagctcctcaaccctatctccaac
cagatgttcgaccagatcgtctccatagggaagctcatcacggatttccatgatgcctcg
gctggtgattcagctgctgcgccatctggtgatggcatggacacagcgctggatgatgac
atcggcgttgctgttgaatttgaagagaacgaagatgacgaggagagcgatttcgatcag
gtgcaagatgatttggatgaagatgaagatgatgacttgcctgagtcgaatgcccctggt
gctatgcaaatgggtggcgagttagatgatgatgatatgcagaactccaacgaggggctg
accataaatgtacaagacattgatgcttactggcttcagaggaaggtctcgcaagcatac
gaagatattgatccgcagcacagtcagaagcttgctgaggagatcttgaagataattgct
gagggtgatgacagagatgtcgagaatcggcttgtcatgctgttggactatgaaaagttt
gatctcattaaactgctactacgcaaccgactcaagattgtttggtgtacccgtttagca
agggctgaagatcaggaacagcggaagaagattgaggaagatatgatgggtaacccaact
ttaactccgatattggagcagctacatgcaacgagggcatctgcaaaggagaggcagaag
aatctagagaaaagtatcagggatgaggccaagaggcttactaaaagcgaaaacactggc
attgatggtgcgagggatcgtagggcagttgaccgggatatggagagtggatggttgaaa
ggccagaggcagctgcttgatcttgacagcctgtccttccaccaaggtggtctcttgatg
gccaacaagaaatgtgagcttcctccaggatcattcagaacccctcataaggggtatgag
gaagtccatgtgccggcgctaaaagctaagccatatgaaactggagagaagattgtcaag
atatctgatatgccagagtgggctcaaccagcttttgctaagatgacacagctgaacagg
gttcagagcaaggtttatgagactgcccttttcaaaccagataatattctcctctgtgct
ccaacaggtgctgggaaaaccaatgtggctgtgctcacaatccttcagcagattgggttg
catatgaaggatggagtgtttgacaataccaagtacaaaattgtctatgtggccccaatg
aaagctttggttgccgaagttgttggaaatttgtcggctcggctgagtgcatatggtatt
actgtaagagagctcagtggagaccagaacctgaccaaacagcagattgatgaaacacag
ataattgtcaccacacctgagaaatgggacattgtcacaagaaaatcaggtgacagaacc
tatactcaaatggtaaagcttctaatcattgatgagatccatctacttcatgacaacaga
gggcctgttctggagagcattgtttctagaactgtccggcagattgagacgaccaaagaa
catatccgtctagttggtctctcagcaactcttccgaactatgaagatgtcgcggttttc
ctgcgtgttcgctctgatggcctcttccatttcgataacagctacagaccttgccccctt
gctcagcaatacattgggatcactgtgaggaagccactacagaggtttcagctgatgaat
gagatttgctacgagaaggttatggcatctgctggaaagcatcaagtgcttatattcgtg
cactcgaggaaggagacagcgaaaactgcccgtgccatcagagatactgcattggctaat
gacacgttaaaccgcttcttgaaggatgatagtgcaagccaagagattcttgggagtcag
gcagaactagtaaaaagcagtgaccttaaagaccttttgccttatgggtttgctattcat
catgctgggttggcaagggtagaccgtgagcttgtagaggagctttttgccgataagcat
atacaggtccttgtctcaacagccacccttgcatggggtgtcaatttgcctgcacacact
gttataataaagggtacccagatttacaatcctgaaaagggtgcgtggacagagctgagt
cctctagatgtcatgcagatgcttggccgtgctggcaggccacagtatgatacacatgga
gagggaataatcctaactggccacagtgaattgcaatattacctgtctctaatgaatcaa
caactgcctattgagagtcagttcatatccagattggctgatcaattaaatgcagagatt
gttcttgggactattcagaatgctcgggaggcatgctcatggcttggctacacctacctc
tacatccggatgctccggaatccaacattgtatggtctaccggcagatatcatggagact
gataaaacactagatgaaaggagagctgacttggtgcactctgctgcaaatctgctcgat
aggaacaatttgataaagtatgacaggaaaacaggatacttccaggttactgacctagga
aggattgctagttattactatattagccacgggactatttcaacttacaatgagtacctg
aagcctacaatgggtgatattgagctatgtcggctcttttcactcagtgaagaattcaag
tatgtcagtgttagacaagatgagaaaatggagctggctaagcttttggatcgtgtgcct
attcctgtgaaagaaagcttggaggagcccagtgcaaagatcaatgttctgctgcaagca
tatatttctaggctgaaattggagggtctttcgcttagctccgatatggtctacatcaga
cagagtgctggccgtctcttacgagcgttgtttgagatagttctgaagagaggatgggcc
caactagcagagaaggctttgaatctttgtaagatgatagataagcagatgtggaatgtc
caaactcccctgcgccaattccctggtattccgaaggaaatcctaatgaaactggagaaa
aaagaattggcttgggagaggtactacgacctatcatctcaggaaattggtgaactaatt
cggttcccgaagatgggcaggcaactgcacaagtgcatccaccagttaccaaagttgaat
ctttcagcccatgttcagccaattactcgtacggttttgggttttgagttgactataact
cctgatttccaatgggatgataaggtacatggatatgtggagcctttctgggttattgtt
gaggacaacgatggcgagaacattcttcaccatgagtacttcatggttaagaaacaatac
gtagatgaagatcatacactcaacttcacagtgccaatatacgagccactgccccctcaa
tactttattcgtgttgtatctgataagtggcttggttctcagacaattcttcctgtctgt
tttaggcacttaattcttccagaaaaatatgctccgccaactgaattgcttgatctgcag
ccactgcctgttactgcattgagaaatgcacgatacgaaggcctttatagtgccttcaaa
catttcaacccaatccagactcaagtgttcactgttctgtacaacactgatgacagtgtt
ttggttgctgcgccaacaggcagtggaaagaccatctgtgcagagtttgctatactaaga
aaccatcagaaggctgtatctggtgagagcaacatgcgagttgtgtatattgctcctatt
gaagcccttgcaaaagaaaggtacagggattgggagcagaaatttggagaatttgctcgg
gtagttgagctaacaggtgaaactgcagctgacttgaagcttctggataaaggggagatt
ataattagtactcctgagaagtgggatgcactctctcgccggtggaaacagcggaaacaa
gtccaacaggtcagcctattcattgttgatgagcttcatctgattggatctgaaaaggga
catgttctggaagtcatcgtctctaggatgaggcgtattgcaagtcatatcggcagtaac
atccggattgtggctctttcagcttcacttgcaaatgctaaagatctcggagaatggatt
ggtgctacctctcatggccttttcaactttcctccagctgtccggccggtgccattagaa
atacacattcagggtgtggatatagcaaattttgaggcaaggatgcaggcaatgacgaag
ccgacatacactgctattacccaacatgcaaagaatggtaaacctgccctggtgtttgtg
cctacacggaagcatgcaaggttgactgcattggacttgtgtgcatactcgagtgctgag
ggtggtggaacacctttccttcttggttcagaagatgagatggatgctttcactggtggt
atcagtgatgaaacacttaaatatactctgaaatgtggtgtaggctacttgcatgaaggt
ttaagtgatctggaacaggaagttgtaacgcagctgtttctcggtgggaggatccaagtg
tgtgttgcgagtagcactgtgtgctggggaagatcattgcctgcccatctggtggttgtg
atgggaacccagtattatgatggccgggagaatgctcatactgattatccaatcactgat
ctactccaaatgatgggtcatgctagcaggcctcttcaagataactcagggaaatgtgtt
atattgtgtcatgcgcctcgcaaggaatactacaagaagttcctttttgaggccttccct
gttgagagccatcttcaccacttcttgcatgatcatatgaacgctgaggtggtggttggt
gtcatagaaaacaagcaagatgctgtggattaccttacttggaccttcatgtacaggcgg
ctgaccaagaaccctaactactacaatctgcagggcgtgagccacaggcatttgtcggac
catttatctgagttggttgagactgtattgaatgacctagaatcaagcaagtgtgtggct
atagaggaggatatgtacctgaagcccctcaaccttggtctgattgcttcgtactactac
attagctacacaactattgagaggttcagttcaatgctaactcaaaagactaagatgaaa
gggctcctggagattctagcctctgcttcagaatatgctgagcttcccagtcgccctggt
gaggaggatttcattgagaagcttgttcgccaccagagattttccatcgagaagcccaag
tatggtgatccacatgtcaaggctaacgcactgctgcaagctcatttttcaaggcacact
atcttagggaacctggcagccgaccagcgggagatactcctttctgctcatagattgctc
caggcaatggttgatgttatctccagcaatggatggcttacgcttgctcttaatgcaatg
gagctgagtcaaatggtgacacaaggcatgtgggatcgtgattctgttcttttacaactt
ccacatttcaccaaggagttggcacggagatgtcaggagaatgaagggaggcccattgag
agcatctttgatctggctgagatgagcatcgatgagatgcgggatctgttgcagcaatca
aaccctcagctgcaggatatcattgaattcttcaagcgtttccccaatgtcgatatggct
tacgaagttcgcgagggtgatgatatcagggctggtgacaatgtaactgtacaggtgacc
ctggagcgtgacatgacgaacttgccttctgaggtggggccagttcatgcccccaggtac
ccaaagcccaaggaagaaggctggtggctggtaattggtgatagctctaccaatcagttg
cttgcaatcaagagggttgcacttcagaagagggctcgagtgaagcttgagttcaccgct
gcttcagaagctgggagaaaggagtacatgatctacctgatgtccgattcttatctgggc
tgcgatcaggagtacgagttcaccgtcgatgtcatggatgctggaggggattga

DBGET integrated database retrieval system