KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276137
Entry
107276137         CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 22 homolog 1-like
  KO
K12188  ESCRT-II complex subunit VPS22
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107276137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107276137
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107276137
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    107276137
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107276137
SSDB
Motif
Pfam: EAP30 CDK5RAP3
Other DBs
NCBI-GeneID: 107276137
NCBI-ProteinID: XP_015615112
UniProt: A0A0P0Y553
LinkDB
Position
11:27090653..27107537
AA seq 252 aa
MRRRPGIAGLQNAAATRDQFRLVGENVAKVRTDVMKEQLATFRTQLEEFALKHKNDIRKN
PLFRQQFHEMCAKVGVDPLASNKGAWAELLGIGDFYYELGVQIVDICIATRATNGGLIDL
LDLRKLLCQKRKADLGSLTSDDCLRAISKLKVLGSGFEVISVGKKKLVRSVPTELNKDHN
GILELAQAEGFVTVEQVKRKFSWSTGRAIDVLETLLKEGLAMIDDGHRDGKRRYWFPCAT
LSSDSIGADAKS
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaggaggcgaccgggaatcgcgggtttacagaacgcggcggctactcgcgaccaattc
cggctggttggggaaaatgtggccaaggtcaggaccgatgtaatgaaggagcagcttgcc
acatttcggacacaactcgaagaatttgcactcaagcataagaatgatatccgtaaaaat
ccactatttagacaacagttccatgagatgtgtgcaaaagttggagtagaccctctggct
tcgaataaaggagcttgggcagaacttctagggattggtgacttctactatgaattggga
gttcagattgttgacatatgcatagcaaccagagcgaccaacggtggcttgattgacttg
ctagatctccgtaaactcctgtgtcagaagaggaaagctgatcttggatccttaacatca
gatgattgtttgcgtgcaataagtaagctgaaggtccttggtagtggttttgaagtaatt
tctgttgggaagaaaaagcttgtacgttctgttcctacagaactgaataaagatcacaat
gggatacttgagctagctcaggctgaaggttttgtcacagtagaacaagtcaagagaaag
ttctcgtggtcaactggccgtgccatcgatgtccttgaaactttgctcaaggaagggctt
gctatgatcgacgatgggcacagggatggcaagcgcagatactggttcccgtgcgccact
ctcagttctgactcgattggtgccgatgccaagtcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269587
Entry
9269587           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 22 homolog 1 isoform X1
  KO
K12188  ESCRT-II complex subunit VPS22
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9269587
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9269587
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9269587
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    9269587
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9269587
SSDB
Motif
Pfam: EAP30 CDK5RAP3 DUF3631
Other DBs
NCBI-GeneID: 9269587
NCBI-ProteinID: XP_015612043
LinkDB
Position
9:complement(20744818..20748508)
AA seq 265 aa
MRRRPGIAGLQNAAATRDQFRLVGENVAKVRTDVMKEQLATFRTQLEEFARKHKNDIRKN
PLFRQQFHEMCAKVGVDPLASNKGAWAELLGIGDFYYELGVQIVDICIATRATNGGLIDL
LDLRKLLCQKRKADLGSLTSDDCLRAISKLKIVNSSGPLPVNSQVLGSGFEVISVGKKKL
VRSVPTELNKDHNGILELAQAEGFVTVEQVERKFSWSTGRAIDVLETLLKEGLAMIDDGH
RDGKRRYWFPCVTLSSDSTGADAKS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaggaggcgaccgggaatcgcgggcttgcagaacgcagcggctactcgtgaccaattc
cggctggttggggaaaatgtggccaaggtcaggaccgatgtcatgaaggagcagcttgcg
acgtttcggacacagctcgaagaatttgcacgcaagcataagaatgatatccgtaaaaat
ccactatttagacaacagttccatgagatgtgtgcaaaagttggagtagacccgctggct
tcgaataaaggagcttgggcagagcttctagggattggtgacttctactatgaattggga
gttcagattgttgacatatgcatagcaaccagagcgaccaacggtggcttgattgacttg
ctagatctccgtaaactcctctgtcagaagaggaaagctgatcttggatcgttaacatca
gatgattgtttgcgtgcgataagtaagctgaagatcgttaattcttctggtcctttgcct
gtgaactctcaggtccttggtagtggttttgaagtaatttctgttgggaagaaaaagctt
gtgcgttctgttcctacagaactgaataaagatcacaatgggatacttgagctagctcag
gctgaaggttttgtcaccgtagagcaagtcgagagaaagttctcgtggtcaactggccgt
gccattgacgtccttgaaactttgctcaaggaagggcttgcgatgatcgacgatgggcac
agggatggcaagcgcagatactggttcccgtgcgtcactctcagctctgactctactggt
gcggatgccaagtcatga

DBGET integrated database retrieval system