KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276142
Entry
107276142         CDS       T01015                                 
Name
(RefSeq) solanesyl-diphosphate synthase 2, chloroplastic
  KO
K05356  all-trans-nonaprenyl-diphosphate synthase [EC:2.5.1.84 2.5.1.85]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107276142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    107276142
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.84  all-trans-nonaprenyl diphosphate synthase [geranyl-diphosphate specific]
     107276142
    2.5.1.85  all-trans-nonaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     107276142
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   107276142
SSDB
Motif
Pfam: polyprenyl_synt HEPPP_synt_1
Other DBs
NCBI-GeneID: 107276142
NCBI-ProteinID: XP_015639579
UniProt: Q75HZ9
LinkDB
Position
5
AA seq 403 aa
MLSVSCPRVYMSRKALDFGQLASCRCRWAGRSGMRVAPRRRMPCVCFVASPSQPGLAAVD
VPAEAISSARTTTMIPERISVSSLLEVVSDDLLKLNNNLKSLVGAENPVLVSAAEQIFGA
GGKRLRPALVFLVSRATAELAGLLELTTEHQRLAEIIEMIHTASLIHDDVIDDSGMRRGK
ETIHQLYGTRVAVLAGDFMFAQSSWFLANLENIEVIKLISQVIKDFASGEIKQASTLFDC
DVTLDDYLLKSYYKTASLLASSTRSAAIFSGVSTTICEQMYEYGRNLGLSFQVVDDILDF
TQSAEQLGKPAGSDLAKGNLTAPVIFALQDEPKLREIIDSEFSESDSLATAIDLVHRSGG
IRRAQELAKEKGDLALQNLQCLPKSQFRSTLENVVKYNLQRID
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgttgtctgtgagctgcccgagagtgtacatgagcaggaaggcgctggatttcggtcag
ctggcctcctgccggtgccgttgggctggccggtccggcatgcgggtggcgccgaggcgg
cgcatgccatgtgtttgtttcgtggcctcaccgagccagccaggccttgctgcagttgat
gtgccagcagaggcgatttctagtgcgagaacaacaacaatgatccctgagcgaatttct
gtttcttcacttttggaggttgtctccgacgacctgctgaaactcaacaataatctgaaa
tcgcttgttggtgcagaaaatccagttttagtttctgcggcagaacaaattttcggtgct
ggtggaaaaaggttaagaccagcattagtttttctggtgtccagagcaactgctgaatta
gctggtttgttggagcttactacagagcatcaacgcctggcagagatcatagagatgatt
cacacagcaagtttaatacatgatgatgtcatagatgatagtggcatgaggagagggaaa
gaaactattcatcagctatatggaacacgggtggccgtacttgctggtgattttatgttt
gcacaatcttcttggttcctagcgaacttagaaaacatcgaagttattaagctcatcagc
caggtgatcaaggactttgccagtggtgagataaaacaagcatctactctttttgactgc
gacgtcacccttgatgattacttgctcaagagctattataaaaccgcttcgttgctcgcc
tcaagcacaagatctgctgcaatattcagtggtgtaagcaccactatatgcgaacaaatg
tatgaatacggcaggaatctcgggctctcgttccaggtagtagatgatattcttgacttt
acccaatcagctgagcaacttgggaaaccagcagggagtgacttagcaaagggaaacctg
acagctccagtcatattcgctttgcaagatgaacccaaactaagggagataatcgattct
gagttcagtgaaagtgattcattggctactgcaatcgacttggttcacagaagtggtgga
ataagaagggcgcaggagcttgcaaaggagaaaggtgacttggctctccaaaatttgcag
tgccttcccaagagccagttcagaagtacccttgagaacgtggtgaaatataatcttcag
aggattgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351957
Entry
4351957           CDS       T01015                                 
Name
(RefSeq) probable solanesyl-diphosphate synthase 3, chloroplastic
  KO
K05356  all-trans-nonaprenyl-diphosphate synthase [EC:2.5.1.84 2.5.1.85]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4351957
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4351957
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.84  all-trans-nonaprenyl diphosphate synthase [geranyl-diphosphate specific]
     4351957
    2.5.1.85  all-trans-nonaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     4351957
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4351957
SSDB
Motif
Pfam: polyprenyl_synt HEPPP_synt_1
Other DBs
NCBI-GeneID: 4351957
NCBI-ProteinID: XP_015620200
UniProt: Q0INZ4
LinkDB
Position
12:complement(9915255..9922702)
AA seq 414 aa
MAAPSSLASSSHLSRRATAAASPSIPPPSPPPPPQRLRCGWVGRAAPPTRRAPGVCSVVS
PSKPGVAAVDVPAATIPDAAATGVGVAERISVSSLLEVVADDLLKLNNNLKSLVGAENPV
LVSAAEQIFGAGGKRLRPALVFLVSRATAELAGLLELTTEHQRLAEIIEMIHTASLIHDD
VIDDSGMRRGKETIHQLYGTRVAVLAGDFMFAQSSWFLANLENIEVIKLISQVIKDFASG
EIKQASTLFDCDITLDDYLLKSYYKTASLIAASTRSAAIFSGVSTAICEQMYEYGRNLGL
SFQVVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALQDEPQLREIIDSEFSETNSLA
TAIELVHRSGGIKRAHELAREKGEIAIQSLQCLPRSEFRSTLENMVKYNLERID
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcggcgccgtcctccctcgcgtcgtcctcgcacctgtcccgccgcgccaccgccgcg
gcgtcgccgtcgatccctcctccttctccccctcctcctccgcagcggctccggtgcggc
tgggtcggacgcgcggcgccgccgacgcggcgcgcgccaggtgtttgctccgtggtctcg
cccagcaagccaggtgttgctgctgttgacgtgccggccgcgacgattcctgacgcggcg
gcgaccggcgtcggcgtcgccgagcgcatttcggtgtcgtcgctgctggaggttgtggcg
gacgacttgctcaagcttaacaacaacctcaaatcgcttgttggtgcagaaaatccagtt
ttagtttctgcggctgaacaaatatttggtgccggtggaaaaagattaagaccggcacta
gtttttctggtatccagagcaactgctgaattggctggtttattggaactaactacagaa
caccaacgtttggcagagatcatagagatgatccacactgcaagtttaatacatgacgac
gtcatagatgatagtgggatgcgaagagggaaggaaactattcatcagctatatggaaca
cgggtggctgtacttgctggtgattttatgtttgcacaatcttcttggtttcttgcaaac
cttgaaaatattgaagttataaagctcatcagtcaggtaatcaaggattttgccagtggt
gaaataaaacaagcatcaacactttttgactgtgacatcacccttgatgattacctgctc
aagagctactacaagactgcttctctgattgcagcaagcacaaggtcagctgccatattt
agtggtgtcagcactgctatatgtgaacaaatgtatgaatacggaaggaatctcggtctc
tccttccaggtagtcgatgacattcttgacttcacccaatcagctgaacaacttgggaaa
cctgcaggaagtgacctggcaaagggtaatctaacagccccggtcattttcgctttgcaa
gatgaaccacagctcagggagatcattgattccgagttcagtgaaacaaattccttggct
actgcaatagagctagttcatagaagtggtggaataaagagggctcatgagcttgcaaga
gagaagggtgaaatagctatccaaagtctgcagtgtcttccaaggagtgagttcagaagc
actcttgagaacatggtgaaatataatctagaaaggattgattag

DBGET integrated database retrieval system