KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276210
Entry
107276210         CDS       T01015                                 
Name
(RefSeq) protein TWIN SISTER of FT-like
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    107276210
SSDB
Motif
Pfam: PBP DUF6758
Other DBs
NCBI-GeneID: 107276210
NCBI-ProteinID: XP_015619436
UniProt: B9GCH5 A0A8J8YKZ1
LinkDB
Position
12:7234881..7237407
AA seq 177 aa
MSMSRDPLVVGSIVGDVVDHFGASALLRLFYNHREMTSGSELRPSQVAGEPAVQITGGRD
GRALYTLVMVDPDAPSPSNPSKREYLHWLVTDVPEGGDTSKGTEVVAYESPRPTAGIHRL
VFIVFRQTVRQSIYAPGWRSNFNTRDFAACYSLGSPVAAAYFNCQREGGCGGRRYRS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgagcatgtcgagggacccgctggtggtggggagcatcgtcggcgacgtggtggaccac
ttcggcgcgtcggcgctgctgaggctgttctacaaccaccgcgagatgacgagcgggtcg
gagctcaggccgtcgcaggtcgccggcgagccggccgtccagatcaccggaggccgcgat
gggagggcgctctacacgctcgtaatggtggaccctgatgcacctagccccagcaaccct
tccaaaagggaataccttcattggttggtaactgacgtaccagaaggaggcgatacgagt
aaagggacggaggtggtggcgtacgagagcccgcggccgacagcggggatccaccggttg
gtgttcatcgtgttccggcagacagtgcggcagtccatctacgcgccggggtggcgctcc
aacttcaacaccagggacttcgccgcctgctacagcctcggctcccccgtcgccgccgcc
tacttcaactgccagagggagggcggctgcggcggccggaggtacaggtcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280190
Entry
107280190         CDS       T01015                                 
Name
(RefSeq) protein FLOWERING LOCUS T-like
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    107280190
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 107280190
NCBI-ProteinID: XP_015627229
LinkDB
Position
2:complement(23585120..23587742)
AA seq 174 aa
MSRDPLVVGNVVGDILDPFIKSASLRVLYSNRELTNGSELKPSQVANEPRIEIAGRDMRT
LYTLVMVDPDSPSPSNPTKREYLHWLVTDIPETTNASFGNEIVSYESPKPTAGIHRFVFV
LFRQSVQQTIYAPGWRQNFNTRDFSALYNLGPPVAAVFFNCQRENGCGGRRYIR
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtcaagggatccacttgttgtaggcaatgtggttggggatatcttggacccatttatc
aaatcagcatcactcagagtgctttacagcaatagggaactgactaatggatctgagctc
aagccttcacaagtagcgaacgagccaaggattgagattgctggtcgtgacatgaggaca
ctttacactttggtgatggtggatcctgactcaccaagtccaagcaatccaaccaaaaga
gaataccttcattggttggtgacggacattccagaaacaacaaatgcgagctttggaaat
gagatagtcagctatgaaagtccaaagccaacagcgggaatacatcgctttgtctttgtg
cttttccgtcaatctgtccaacagaccatttatgcacctggatggcgacaaaattttaac
acaagggatttctcggcactttacaacctaggaccaccggtggctgccgtgttcttcaac
tgccaaagagagaatggttgtggtggcagacgatacattagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324585
Entry
4324585           CDS       T01015                                 
Name
(RefSeq) protein HEADING DATE 3B-like
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4324585
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 4324585
NCBI-ProteinID: XP_015611892
UniProt: Q5QNE3 Q0JPK3
LinkDB
Position
1:6494419..6499806
AA seq 276 aa
MTGSSCPADSSQLLYPRRGAPTTTTTSRPPLHPLIAHAPYDVVLHRSVVLSISSARDQAE
LASFWCYIRLGGGASAKRAAGEDDRSRSSLTAARGGGGETMSGRGRGDPLVLGRVVGDVV
DPFVRRVALRVAYGAREVANGCELRPSAVADQPRVAVGGPDMRTFYTLVMVDPDAPSPSD
PNLREYLHWLVTDIPATTGVSFGTEVVCYESPRPVLGIHRLVFLLFEQLGRQTVYAPGWR
QNFSTRDFAELYNLGLPVAAVYFNCQRESGTGGRRM
NT seq 831 nt   +upstreamnt  +downstreamnt
atgacgggcagtagttgtccggccgattcttcccagctgctgtaccctcgccggggtgcc
cccaccaccaccaccacctcccgtcctcctctccatccgctcatcgctcatgcgccctac
gacgtcgtcctccaccgatctgtcgtcctctccatcagctcagctcgtgatcaggctgag
ctcgcgagcttctggtgctatataaggctgggtggtggtgcaagtgcgaagcgagcggcc
ggtgaggacgatcgatcgagatcgagcttgacggcggcgagaggaggaggaggggagacg
atgagcgggcgggggaggggggacccgctggtgctggggagggtggtgggggacgtggtg
gacccgttcgtgaggagggtggcgctgcgggtggcgtacggagcgcgggaggtggccaac
ggctgcgagctccgcccctccgccgtcgccgaccagccccgcgtcgccgtcggcggcccc
gacatgcgcaccttctacaccctggtgatggtggatccggacgcgccgagcccgagcgat
ccaaacctcagggagtacctgcactggctggtcaccgacatcccggctaccacaggagtc
tcttttgggacagaggtggtgtgctacgagagcccgcggccggtgctggggatccacagg
ctggtgttcctgctgttcgagcagctggggcggcagacggtgtacgcaccggggtggcgc
cagaacttcagcacccgcgacttcgccgagctctacaacctcggcctccctgtcgccgcc
gtctacttcaactgccagagggagtctggaaccggaggaagaagaatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336228
Entry
4336228           CDS       T01015                                 
Name
(RefSeq) protein FLOWERING LOCUS T
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4336228
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 4336228
NCBI-ProteinID: XP_015633387
UniProt: B9FFU4 Q7XUF1
LinkDB
Position
4:complement(24391382..24395755)
AA seq 174 aa
MSRDPLVVGHVVGDILDPFNKSASLKVLYNNKELTNGSELKPSQVANEPRIEIAGRDIRN
LYTLVMVDPDSPSPSNPTKREYLHWLVTDIPESANASYGNEVVSYESPKPTAGIHRFVFI
LFRQYVQQTIYAPGWRPNFNTRDFSALYNLGPPVAAVFFNCQRENGCGGRRYIR
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtcaagggacccacttgtcgtaggacatgttgttggggatatcttagacccattcaac
aaatcagcatcactcaaggtcctatacaacaacaaggaattaacaaatgggtctgagctc
aaaccgtcacaggtagcaaatgaaccaaggattgaaattgctggccgcgacataaggaac
ctttacactctggtgatggtggatcctgactcgccaagtccaagcaacccaacaaaaaga
gaataccttcattggttggtgacagacattccagaatcggcaaatgctagttatggaaat
gaagttgtcagttatgaaagcccaaaaccaactgcagggatacatcgttttgtctttata
ttatttcgccaatatgtacaacagactatttatgcaccaggatggagaccaaatttcaat
acaagagatttttccgcactgtataatcttggacctcctgtggcagcagtgttcttcaat
tgccagagggagaacggatgtggaggcagacggtacattagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340185
Entry
4340185           CDS       T01015                                 
Name
(RefSeq) protein HEADING DATE 3A
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4340185
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 4340185
NCBI-ProteinID: XP_015641951
UniProt: Q93WI9 E5RQ78
Structure
LinkDB
Position
6:2939996..2942402
AA seq 179 aa
MAGSGRDRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGG
NDMRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTAASFGQEVMCYESPRPTMGIH
RLVFVLFQQLGRQTVYAPGWRQNFNTKDFAELYNLGSPVAAVYFNCQREAGSGGRRVYP
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccggaagtggcagggacagggaccctcttgtggttggtagggttgtgggtgatgtg
ctggacgcgttcgtccggagcaccaacctcaaggtcacctatggctccaagaccgtgtcc
aatggctgcgagctcaagccgtccatggtcacccaccagcctagggtcgaggtcggcggc
aatgacatgaggacattctacacccttgtgatggtagacccagatgcaccaagcccaagt
gaccctaaccttagggagtatctacattggttggtcactgatattcctggtactactgca
gcgtcatttgggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccac
cggctggtgttcgtgctgttccagcagctggggcgtcagacagtgtacgcgcccgggtgg
cgtcagaacttcaacaccaaggacttcgccgagctctacaacctcggctcgccggtcgcc
gccgtctacttcaactgccagcgcgaggcaggctccggcggcaggagggtctacccctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341272
Entry
4341272           CDS       T01015                                 
Name
(RefSeq) protein FLOWERING LOCUS T isoform X1
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4341272
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 4341272
NCBI-ProteinID: XP_015641828
UniProt: A3BCN0 Q5Z9D9
LinkDB
Position
6:complement(20971878..20982449)
AA seq 173 aa
MANDSLTRSHIVGDVLDQFSNSVPLTVMYDGRPVFNGKEFRSSAVSMKPRVEIGGDDFRF
AYTLVMVDPDAPNPSNPTLREYLHWMVTDIPSSTDDSFGREIVTYESPSPTMGIHRIVMV
LYQQLGRGTVFAPQVRQNFNLRSFARRFNLGKPVAAMYFNCQRPTGTGGRRPT
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcaaatgactcattgacaaggagccatatagttggagatgtgttagaccaattttca
aactcagtgcctctaactgtgatgtatgatgggaggcctgtgtttaatggcaaggagttc
cgttcctcggcagtctcgatgaaacctagagttgagattggtggcgatgattttcgattt
gcctataccctagttatggtggatcctgatgctcctaatcccagcaacccaaccttgagg
gaatacctgcactggatggtgactgatatcccatcatcgacggacgatagctttgggcgg
gagatcgtaacatacgaaagcccaagccccaccatgggcatccaccgcatcgtgatggtg
ttgtatcagcagcttgggcgcggcacggtgttcgcgccgcaggtgcgtcagaacttcaac
ctgcgcagcttcgcgcgccgtttcaacctcggcaagccggtggccgccatgtacttcaac
tgccagcgcccgacaggcacaggtgggaggaggccaacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268282
Entry
9268282           CDS       T01015                                 
Name
(RefSeq) protein FLOWERING LOCUS T
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    9268282
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 9268282
NCBI-ProteinID: XP_015611907
LinkDB
Position
9:complement(19980213..19986378)
AA seq 178 aa
MSRGRDPLALSQVIGDVLDPFIKSAAMRINYGEKEITNGTGVRSSAVFTAPHVEIEGRDQ
TKLYTLVMVDPDAPSPSKPEYREYLHWLVTDIPEAIDARFGNEIVPYEAPRPPAGIHRLV
FVLFKQEARQTVYAPGWRQNFNVRDFSAFYNLGPPVAALYFNCQKESGVGGRRFQGPS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtcacgaggtagggatcctttggcattgagccaggtaattggcgatgtgttggatcct
ttcataaagtcagctgcaatgaggattaattatggtgagaaggagattacaaatggaact
ggagtacgatcatctgctgttttcactgcaccacatgttgagattgaaggtcgtgaccaa
acgaagctctacacacttgttatggtggatcctgatgcgccaagtccaagcaaaccagaa
tacagggaatatttgcattggttggtgacagacatcccagaggcaatagatgcacgtttt
ggcaatgaaatagttccgtacgaagctccacggccaccggctggaattcatcggcttgtt
tttgtgctattcaaacaggaagcacgacaaacagtttatgctccaggatggcggcaaaat
ttcaacgtcagagatttctctgcattttacaatcttggaccacctgttgctgcattatac
ttcaactgccagaaggagagtggtgttggtggcagaaggtttcagggaccaagttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271430
Entry
9271430           CDS       T01015                                 
Name
(RefSeq) protein FLOWERING LOCUS T isoform X1
  KO
K16223  protein FLOWERING LOCUS T
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    9271430
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 9271430
NCBI-ProteinID: XP_015630200
LinkDB
Position
1:5643845..5655687
AA seq 184 aa
MLEEMSSANSLVLGRVIGDVVDLFSPEVTLRVMYNGVRVVNGEDLRPSAVSARPSVEVGG
DLHQFYTIVMVDPDAPNPSNPTLREYLHWLVTDIPGTTDANYGREVVCYESPRPAAGIHR
VAVVLFRQMARGGVDQPPLLRHNFSTRGFADDHALGAPVAAAFFTCKPEGGTGGRRFRPP
SRHS
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcttgaagagatgtcgtcggcgaacagcctggtgctggggcgggtgatcggcgacgtg
gtggacctgttctcgccggaggtgacgctccgggtgatgtacaacggcgtgcgggtcgtc
aacggcgaggacctccggccgtcggcggtgtcggcgaggcccagcgtcgaggtcggaggg
gatctccaccagttctacacgatcgtgatggtggatccagatgctccaaacccaagcaat
ccgacgttgagagagtacttacactggttggtgacagatattcctggaacaactgatgcg
aactatgggcgcgaggtggtgtgctacgagagcccccggccagcggcggggatccaccgg
gtggcggtggtgctgttccggcagatggcgcgcggcggcgtggaccagccgccgctgctc
cgccacaacttctccacccgcggcttcgccgacgaccacgccctcggcgcccccgtcgcc
gccgccttcttcacctgcaagcccgagggcggcaccggcggccgccgcttccggccaccg
tcacggcatagctag

DBGET integrated database retrieval system