KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276215
Entry
107276215         CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1-like
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276215
SSDB
Motif
Pfam: NB-ARC AAA_16 Rx_N AAA_22 LRR_8 Phi-29_GP16_7 Recep_L_domain TGF_beta_GS
Other DBs
NCBI-GeneID: 107276215
NCBI-ProteinID: XP_015649202
LinkDB
Position
8:complement(5466374..5469262)
AA seq 962 aa
MALARSTAMGVVTSLGLGGVHSSIAAAEHELSLLRGHLRSGGASCRGADDDDQDPIDSWA
NQVRDVAFQLDDITDECCFLSGSGSGHGFARYCANVPTWIALSRRLRKVREKLGQLLEAA
NYQRQRVDVMNNFVSCGELRREDDAVAAGRRMAENARSMDKEEIIGFSDHREVLVRWLLA
EDAAEPRRRTLLAVCGMGGVGKTTLVASVYKEVTAPAAAPASHHFDCDAWVTVSQRFTME
DLLMKILRKLNLNTVGRRAGTGRRRRRSATDVGDGGGDTDYGSLVAALRERLANKRYLIV
LDDVWDETLWDGLERAMPDGDGVAGSRVVITTRKSGVAMAAAPERTMALEPLPTHQGWAL
LCSVVFKDVPGHRCPSHLREVAGDMLERCRGLPLAIVAVGKLLRHKDRTEFAWRNVRDSL
AWVKNSEDLGIGEASRILNLSIDDLPYKLKKCFLSCSIYPEDFLIKRKILIRSWVAQGFI
DEAKEVHGERRTMEDVADHYLDKLVQRSLFQVAVRNEFGRAKRFLIHDLIKDLINHRSKH
EEGFVQFAECDLTMDSNIRVRHLALDRCTSSRRSASAAKIAALRSFQAFGSKLDASLMSC
FRLLTVLNLWFIEINKLPSTVTNLRNLRYLGIRSTFIEELPKDLGKLQKLQTLDTKWSMV
QKLPSSLSKLKSLRHLILLKRHAADYYRPYPGTPVGQLPAGLQNLTSLQTLNYVRADEMI
SKSLAKLEQMKSLELFDVDASFAAVLSSSILKMSHLQRLGLTNSNTESVIDLESITVAPR
KLQKLALSGRLARGKLPGWTCFLTSLKQVHLIASGIAQDSLLLLSSLPGLLHLSLNAAYR
EKEMTFAAGGFPALQTLTLHELSNLSQIEFQRGCLAELHELVLDKCTKLADSPKGMENLT
RLQNLKLVGMAPELMEKLQDGKGDDGCYYKPGTGSSMICQVPSPSRYHMKSIVFLKPPAV
LV
NT seq 2889 nt   +upstreamnt  +downstreamnt
atggctctagcccgcagcacggcgatgggcgtcgtcacctccctcggcctcggcggcgtc
cactcctccatcgccgccgccgagcatgagctcagccttctccgcggccacctccgcagc
ggaggagcctcctgccgcggcgcggacgacgacgaccaagaccccattgatagctgggcc
aatcaggtccgtgacgtggccttccagctcgacgacatcaccgacgagtgctgcttcctc
tccggctccggctccggccatggcttcgcgcggtactgcgccaacgtcccgacctggatc
gccctctcgaggaggctacgcaaggtgcgggagaagcttggccagctgttggaagcggcg
aattaccagcggcaacgcgtcgacgtgatgaataattttgttagctgcggcgagcttcgc
cgcgaagatgatgccgtcgccgctggccggaggatggcggagaacgcgcgctccatggac
aaggaggagatcatcggcttctccgatcaccgggaagtgcttgtgagatggctgctggct
gaggacgcggcggagccacgccggcggacgctgctcgccgtgtgcgggatgggcggcgtc
ggcaagacgaccctcgtcgccagcgtctacaaggaggtgacggcgccggcggcggcgccg
gcgagtcaccacttcgactgcgacgcgtgggtcaccgtctcgcagcgcttcacgatggag
gacctcctgatgaagatcctcaggaagttgaacttgaacaccgtcggtcgtcgtgctggt
actggtaggcggcggcggcgaagcgccaccgacgtcggtgacggcggcggcgacacagac
tacgggtcgctcgtggcggcgctgcgggagcgtctcgccaacaagaggtacctgatcgtg
ctcgacgacgtgtgggacgagacgctgtgggacggcctggagcgcgccatgcccgacggc
gacggcgtcgctgggagccgggtggtgatcaccacgcgcaagagcggagtcgccatggcc
gcggcgccggagaggacaatggcgctggagccgctgccgacgcaccaagggtgggcactc
ctttgcagcgtcgtgttcaaggatgttcccggccacaggtgcccgagccacctcagggag
gtcgccggagacatgctggagcggtgccgcggcttgccgctggccatcgtcgccgtcggc
aagctcctcagacacaaggataggacagagttcgcctggaggaacgtccgtgacagccta
gcctgggtcaagaacagcgaagatcttggcattggagaggcctccagaatactgaacctg
agcatcgacgatctgccatacaaactgaagaaatgcttcctgagttgcagcatatatcct
gaggacttcttgatcaagaggaagatcctgatcaggagctgggttgcgcagggcttcatc
gacgaggcaaaggaagtacatggcgagaggaggacgatggaggatgtcgcagatcattac
ctggataaattggtacaacgtagtctctttcaggttgctgtcaggaatgagtttggccgt
gccaagcggttcctcatccatgacctcatcaaggatttgatcaatcacaggtccaaacat
gaagaggggtttgttcagttcgcggagtgcgatctaacaatggattctaacattagggtt
cgccatctcgcactcgacagatgcaccagcagcaggcgatctgcatctgctgcgaagatc
gccgcgcttcgctccttccaagcatttggttcaaaacttgatgcctcgctgatgtcttgc
ttcaggctattgactgtgctgaatctatggttcatcgagatcaataagctgcccagcaca
gtgaccaatcttcgcaatttgcgataccttgggatacgatctacgttcatcgaagagctt
ccaaaggatctaggcaaattacagaagctgcaaactctggataccaagtggtccatggtc
caaaagttaccaagcagcttgtcgaaactgaagagcttgcgccacttgatactgcttaag
cgccatgccgctgactactataggccctatcctggcacgccagtaggacaacttcctgca
gggttacaaaacctgaccagccttcagacactaaattatgtcagagctgatgagatgatc
tccaaatctttagccaagctggagcagatgaagagcctggagttgttcgatgtggatgca
agctttgccgctgttctgtcatcgtctatattgaaaatgagccacctgcaacgcttgggg
ctcactaacagtaacacggagagtgtaatagatttggagtccatcactgtagcgcccagg
aagctacagaagcttgctttgtctggaaggttagcaagagggaaactgccaggatggacc
tgcttccttacaagcctcaagcaggttcatttgatcgcgagcggaattgcgcaagattca
ctcttgcttctttcgtcgctgccagggcttctgcatcttagcctcaatgccgcctaccgt
gagaaggagatgacctttgccgcaggtggctttcctgcactccagacactcaccttgcat
gagttgagtaaccttagtcagatagagtttcagagaggatgccttgctgagctacatgaa
ctggtgcttgacaagtgcaccaagctagctgattcaccaaaaggcatggagaacctcaca
cgtctccagaatctgaaacttgttggaatggcaccagagctgatggagaagctgcaggat
ggaaaaggagatgatgggtgttattacaagcctggcactggcagctcaatgatctgtcaa
gtgcctagcccttcaagataccatatgaaatcaatagttttcctaaaaccaccagcagtg
ctcgtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276258
Entry
107276258         CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1-like
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276258
SSDB
Motif
Pfam: NB-ARC Rx_N AAA_16 AAA_22 AAA_14 AAA_5 ATPase_2 LRR_8 AAA_7 CbiA
Other DBs
NCBI-GeneID: 107276258
NCBI-ProteinID: XP_015612905
UniProt: Q10A41 A0A8J8YQ91
LinkDB
Position
10:4262392..4266435
AA seq 923 aa
MAEGVIGSLILKLGDALGNESCQLGSSLLVYEASALKGLFGEIRMIKEELESMQAFFCTA
ERFKDTDETTVAFVKQIRGLAFDIEDVIDEFTYKLGEDREGMFLLKAFRRIRQIKTWYRL
ANSLQDIKVSLKSAAERRCRYDLKGVRRERKLMRLGSLNQRSTESVHFKREADLVGIAEN
KQLLMDWLKDEEQQHMIITVWGMGGVGKTTLVAHVYSAIKTDFDTCAWITVSNSYEADDL
LKQIVAEFRKNDRKKEFPKDVDVTDYRSLVETIRLYLEKKRYVLVLDDVWSVNVWFDIKD
AFSGGKHGRIIFTSRIYEVALLAPESQKINLQPLQNHYAWDLFCKEAFWKSENRSCPVEL
HPWAQRFVDKCKGLPIAIVCIGRLLSFKSANLLEWENVYRNLEMQFTNNYILDMNIILKV
SLEDLPHNMKNCFLYCSMFPENYVMQRKWLVRLWIAEGFIEESEHKTLEEVAEDYLTELI
NRCLLVEVKRNESGYIDDFQMHDIFRVLALSKAREENFCFVLDYTKTHLIGKARRLSIQR
GDISQIAENVPHLRSLLVFHNSLSFNSLRLFARSVKLLSVLNLQDSSIESLPNDVFDLFN
LRFLGLRRTNIAYISRSIGRLQNLVVLDAWKSKIMNLPEEIIRLSKLTHLIVTVKPVITS
MNFVPSVGIPAPTGLWSLGCLQTLLLMEASSEMVFYLGALVNLRSFRISKVQGRHCAKLF
VAITNMFHLVRLGIHANDNQEVLQLEALKPSPLLQKLILQGALDKESLPQFFMSISKLKS
LTILRLVWSKLDEEDFYYLEELQQLVKLQLYDAYNGKRLSFQATSFPKLRILKIWGAPHL
SLIKIERGAMSSMVDLKLLLCPELKLLPRGIEHVTTLEEMTLDSTAEELVGRVRKKNEAR
ISHVKRVYVGFIRNGELAAERIQ
NT seq 2772 nt   +upstreamnt  +downstreamnt
atggctgagggcgtcattggctcgttaatcctgaagctaggtgatgccttgggtaatgaa
tcttgccagctgggatcgtcattgctcgtttatgaggcatctgctctgaaaggcctgttt
ggcgagatacggatgatcaaggaggagctggagagcatgcaggccttcttctgcaccgct
gagcggttcaaggatactgatgagacaacagttgcattcgtgaagcagatcagaggcctt
gcattcgacatcgaggatgttatcgatgagttcacctacaagttgggagaagatcgcgaa
ggcatgtttctgctgaaggcattcaggaggatcagacagatcaagacatggtatcggttg
gccaacagtctgcaggatatcaaagttagcctcaagagtgctgcagagaggaggtgcaga
tatgacctgaagggtgttcgaagggagaggaaactgatgcggttagggagcttgaatcag
agatctacagaatcagtacatttcaagagggaagctgatcttgtggggattgctgagaac
aaacagctgttgatggattggttgaaagatgaggagcagcagcacatgataattactgta
tggggtatgggcggtgtcggtaaaacgacacttgttgctcatgtttacagtgctatcaag
actgactttgatacttgtgcttggatcacagtgtctaatagctatgaagccgatgatttg
ctgaaacaaattgttgcggagttccggaagaatgaccgcaagaaggagttcccaaaggat
gtcgatgtcacagattatagaagcctggttgagacaatccgactttacctggagaagaaa
aggtatgttcttgttttagatgacgtgtggagtgtgaatgtttggtttgatatcaaagat
gcattttctggtgggaaacatgggcggataatttttacatctaggatctatgaggtcgct
ctacttgctcctgaaagccaaaagattaaccttcaacccttacaaaatcactatgcatgg
gaccttttttgtaaagaggcattttggaagtctgaaaacaggagttgtccagtagaattg
cacccttgggcccaaaggtttgttgacaagtgcaagggcttgccaatcgctatagtgtgc
atagggcgcctcctttcattcaagagtgcaaatttgttggagtgggagaatgtgtacaga
aatcttgagatgcagtttaccaacaattacatccttgacatgaacataatcctgaaggtt
agtttggaagacttgccacacaacatgaagaattgcttcctctattgctccatgttccca
gaaaattatgtgatgcaaaggaagtggttagtacggctttggattgcagaaggatttatt
gaagagagtgagcacaagacgctggaggaggtagcagaggattacttgaccgaacttatt
aacagatgtttgttagtggaggtcaagaggaatgagtctggatatattgatgatttccag
atgcatgatatatttcgtgttttagctcttagcaaggcacgagaagagaacttttgcttt
gtcttagactacacaaagactcatcttattggcaaagcacgccgtttgtcgattcaaagg
ggggatatctcacaaattgcagaaaatgtgccacatctgcggtcattgcttgttttccac
aattcacttagtttcaattcacttcgtttgtttgcaaggtctgtgaagttactgtctgtc
ctgaatctgcaagatagttcaattgagagtctacccaatgatgtgtttgatttgtttaac
ttacgttttctgggccttagacgaactaatattgcatatatctcaagatcaattgggaga
cttcaaaatttggtcgtgttggatgcttggaaaagcaaaattatgaacctaccagaggaa
attataaggctatctaagttgacacatcttattgtgactgtgaaaccagtgattacttct
atgaattttgttccttctgttggcatacctgcacctactggtttatggtctttgggatgt
ttgcagaccttattactgatggaagctagttctgaaatggtcttttaccttggtgctctg
gtgaatttgagatcatttcgcatcagcaaagtacaaggccgccattgtgccaagctgttt
gtggcaatcaccaatatgtttcatcttgtccgcctcgggatacacgcaaacgacaatcag
gaggttctacaacttgaagcattgaaaccatctccgttacttcagaagcttatcttgcag
ggggcattagataaagaatcattgcctcagttcttcatgtcaatcagtaaactgaaaagc
ctcaccattctacggcttgtctggtcgaaactcgacgaagaagacttctactatcttgag
gaattacagcagctagtgaagcttcagctttatgatgcatataatggcaagaggctgtct
ttccaggcaacatcatttccaaagctcaggatactgaagatctggggagctcctcacctc
agtctgatcaagatagaaagaggggccatgtcaagcatggttgatcttaagctcctgctc
tgccctgaattgaagttgttgcctcgcggcattgagcatgtgaccactctcgaagagatg
actttggattctacagcagaggagcttgtgggcagggttaggaagaagaatgaggccagg
atttctcatgtcaagagagtttatgttgggttcatcagaaatggtgagctggctgcagaa
aggatacaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277214
Entry
107277214         CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1-like isoform X1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107277214
SSDB
Motif
Pfam: NB-ARC Rx_N AAA_22 AAA_16 NACHT ATPase_2 LRR_8 Tom37_C AAA_14 AAA_18
Other DBs
NCBI-GeneID: 107277214
NCBI-ProteinID: XP_015649085
UniProt: A0A0P0XC04
LinkDB
Position
8:3107797..3113305
AA seq 927 aa
MAEGVVFAALCKIGSVLASSASITLGGRLDANLTIINEIESRIKQIEVELKLMQAFLRQA
QKQEGYSEPTEVYLQEVRKAAFEIEDIIDEFLYLSVKHKNRFFNGEFMSYFRKLGKTSWH
KIARELKDSQCHLQNLRNLWVQYEIQLPNGNRVSTDVEDHRLPHHLSYPADEMVGVEQER
TMMMNWLKTCSTSVITVWGMGGSGKTTLANSIYEDERIKNQFDCHIWITVSQKFNASDIM
RKMVRHMLQRCSPNIDSIDGRDLVEILKRTLEHRKILLVLDDVWSTDVWMDLASTVERSN
NNGNKVVITTRIKDVASLASEDQVLQLQKLNDADSWCLFCRWAFKNRIDRSCPQELESLG
REIMVKCDGLPLAIVVVGNMLSFKKQDMEEWSKCNDQLTWELRDRLRDQELSSVMKILKL
SYKNLPSHLKNAFVFCSIFPEDYMITKKRLVRLWVAEGLIKPEKRRTVEEVAEEYLNELI
DRCLLQVVERKHFRKVKEFQMHDIVRELAISISEDETFCMTHSKSHPGEPEYRCRRLSIH
EHNDRIKSVSDPSRLRSLYHFDVTCSSFPSVGTPRSARYLNVLELQDVPITVLPEELSGL
FNLRYLGLRRTKIKQLPQSVDKLFNLQTLDVYLTNVDKLPTGIAKLKRLRHLLAGKLSAP
LYCGIVEKSRGVQAPKVVWESMELQTLKGVLANLNLVENLGHMTQLRTLAIEDVGEEHYP
KLFASISKMRSLRTLKVLSAEGNQGLNFEALSLPPQNLRKLHLTGRFHHAVMESNFFQTV
GAKLEKLYLTGSKTNIDPLISISCLSNLKVLQIGDAYDGASFVFQSGWFPKLHTLIMCNL
LHINSMIMEQQTLQNLQWLALVNFPELKEVPHGIELLLSLQNLMLVNMHDEFMERIQGED
KERVQHISTVRFLDRSRGMEKRLFQES
NT seq 2784 nt   +upstreamnt  +downstreamnt
atggcagaaggcgtggtattcgctgctctatgcaaaattggatctgtcttggcatcatct
gcaagcataacattaggtggacgtttagatgcaaacttgacaataataaatgagattgag
agtcgaataaaacagatcgaagttgagctcaagttgatgcaagcattcctgcgccaagcg
caaaaacaagaaggctatagcgagcccactgaagtctacctgcaggaagtaagaaaagca
gcttttgaaattgaggacatcatcgatgagtttctttacctgtctgttaagcacaagaac
aggtttttcaatggggagttcatgagttacttccgtaaactcggtaaaacttcttggcac
aaaattgctagagagctgaaggattcgcaatgtcaccttcagaatctccggaatttgtgg
gtgcagtatgagattcagcttccaaatggcaatagagtttcaaccgatgtggaggatcac
cggcttccgcatcatctttcttacccagctgatgagatggtgggtgttgaacaagaaaga
acaatgatgatgaactggttaaaaacatgttcgacatcggttatcactgtctggggtatg
ggaggatctgggaaaaccactcttgccaatagtatctatgaagatgagagaatcaagaat
cagtttgattgccatatttggatcacagtgtctcagaagttcaacgcttctgacatcatg
aggaagatggtacgtcacatgttgcaacggtgttcacccaacattgatagcatcgatggt
agagacctggtagaaatcctgaagagaacattagaacatagaaagattttgcttgtacta
gatgatgtatggagcacagatgtttggatggacctggcaagtacagttgagagaagcaac
aacaatggaaataaggtcgtaataacgactcggatcaaagatgtcgcttctttggcaagc
gaagatcaggttcttcagctgcaaaagctgaatgatgcagattcttggtgtctcttttgc
aggtgggcattcaagaaccgcattgatagatcttgtcctcaagaactagagtcattgggg
agagagatcatggtcaagtgtgatggtttgccattagcaattgtggttgtgggtaacatg
ctctcattcaagaaacaagatatggaagagtggagcaagtgcaatgatcagctaacctgg
gaattacgcgacagattgcgcgaccaggagttgagttcagtgatgaagattctgaaactg
agttataagaacttaccgagccacctaaagaatgcatttgtgttctgcagcatctttcca
gaggattacatgataacaaagaaaaggctggtcagactatgggttgcagagggcctcatt
aagccggaaaagagaagaacagtagaagaagtcgccgaggagtacctgaatgagctgata
gaccgatgcctgctacaggttgtggagaggaagcacttcagaaaggtgaaggaattccag
atgcatgacattgtgagggagctggccatttccatatcagaggacgagaccttctgcatg
acacatagtaaatcgcaccccggtgaacccgaatacaggtgccgtcgtttgtcgatacat
gagcacaatgacaggatcaagtcggtttcagatccttctcgactccgctcgctctaccat
ttcgatgtaacctgttcttcttttccatctgtgggtacaccaagaagtgcaaggtatctg
aatgttctggagctgcaggatgttcctatcacagttctgccagaagaattgtcaggctta
tttaacttacggtacctcggtttgagaagaacaaagatcaagcagttgccacaatcagtc
gacaagctgttcaatctccaaacacttgatgtttaccttacaaatgtagacaagttgcca
actgggatcgccaagctgaagaggttaaggcaccttcttgcaggaaagttgagtgctcca
ctgtattgcggcattgttgagaagtccagaggtgttcaagctccaaaggtggtgtgggag
tctatggagctgcaaactcttaagggtgttcttgcaaacctaaatcttgtggaaaatttg
ggacacatgactcaactgaggacattggcgatcgaagatgtcggagaagaacactatccc
aagctctttgcatccatcagcaaaatgcgctctctacgcacactgaaagttctttcagct
gaaggtaatcaaggtctgaactttgaagcactgagcttaccaccacagaatttacgcaaa
ctccatcttaccggaaggtttcaccatgctgtgatggaatccaatttctttcagacagtt
ggagctaaactggagaagctgtatctcacaggaagtaagacgaacattgatccattgatc
tccatctcctgcctctccaacctgaaagtgctccagatcggagatgcatacgacggagca
agcttcgtcttccagagcggatggttccccaagctccacacactcatcatgtgcaacttg
ttgcacatcaattcgatgatcatggagcagcagacgttgcagaacctccagtggcttgca
ctggtcaacttccctgagctcaaggaggtgcctcatggcattgagcttctcttgtcactg
cagaatttgatgctggtgaacatgcatgatgagttcatggagcgtatacagggtgaggac
aaggagagagtccagcacatctccactgtcaggttcttggacaggagcagaggcatggag
aaacgcctgtttcaagagtcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323952
Entry
4323952           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4323952
SSDB
Motif
Pfam: NB-ARC LRR_8 AAA_16 HU-CCDC81_euk_2 AAA_25 DUF2862
Other DBs
NCBI-GeneID: 4323952
NCBI-ProteinID: XP_015630189
LinkDB
Position
1:18612718..18616891
AA seq 792 aa
MVGDGNNPSNDSSNYIVERSQHLASISRSLGEEDLVGVNQNRETLEEWLADDLLERSVIT
LHGMGGLGKTALAANAYMREKEKFQCHAWVSISQSYCIKDVLKCLITELSRNVKKTNWGN
ITDMDTGGFREELKRFLKLQKCLIVLDDVWAPEVINDLFGAHVPNLKGSRILVTTRIDDV
AQLAFPDRRITLEPLCEKESWELFCRTAFPRETNHECNAELLHLIDQIVSKCKGVPLAIV
SIGRLVFVRDKTKEELRRIHDQLDWELINNPSLEHVRNILYLSYIYLPTQLKSCFLYCSL
FPEDHLLKRKALIRWWIAEGFISKRGRSTMEEVAEGYLQELVNRNMLQLIDRNSFGRIKS
FRMHDIMHELAVDLCRRECFGVAYDEDNRRWEHEDRDERRLVVHKLNKDIDQEISCAHSL
RSVITLDNSMISSSSILCLVVDNCRYMSILELSGLPISTVPDAIGDLFNLRHLGLRGSNV
KFLPKSIEKLTNLLTLDLFRSSILELPRGIVKLTKLRHLFAEKQTDRHRRLFRWCTGVSI
PRGLENLTSLQSLQALEAQDESVRCLGELRQMRGLRLWKVKASLCERLYESLLQMKCLSY
LSITASDEDDVLQLDGLNPLPPSLHKLRLSGRLAHTMLGAESPLFQEDAGGRNLYSLRLF
WSQLKEDPLPSLSRLLNLTELHFTRAYNGEKLVFLTRWFPKLKVLRLRDLPNLKRMDIQQ
GAMVSLERLRLINLSSMEEVPLGIEFLMPLKYLSFEEITVDFLLSLRQSRIGGMRWWHTL
REENDMEAGVRT
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggtaggtgatggtaataatcctagtaatgacagctcaaattacattgttgagaggtcc
caacatctagcaagcatttcacgctcccttggtgaagaagatcttgttggggtcaatcaa
aatagagaaacacttgaagagtggctggcagatgatttgttggaacgttcagtaattacg
ctgcatggaatgggagggcttggaaaaacagccttggcagcaaatgcatacatgagggag
aaagaaaagtttcagtgtcatgcatgggtctcgatttctcaatcttactgcatcaaggat
gttctaaaatgtttgatcactgaactttccagaaatgtgaaaaagactaattggggtaac
attactgacatggatactggaggttttcgtgaagagctgaagagattcctaaagctccag
aagtgtttgatcgtattggatgatgtttgggcgccagaagtaatcaatgatttgtttgga
gcacatgttcctaatctcaaagggagcagaatacttgtgacaacacgtatcgatgatgta
gctcaacttgctttcccagacaggagaataacattagaacctctatgtgagaaggaatca
tgggaactcttctgtagaacagcttttccaagggagacaaatcatgagtgcaatgcagaa
ctgttgcacttgatagatcaaatagttagcaagtgtaagggggttcctctggcaattgtc
tctattggcaggcttgtctttgtgcgtgacaagaccaaagaggaactgaggagaatacat
gaccagctcgactgggagttaataaataatccaagcctggaacatgtcaggaatatcctt
tacttgagctacatttaccttccaacacagttgaaaagttgtttcctatattgcagcttg
tttccggaggatcatcttctcaaaagaaaggcattaatacggtggtggatagcggaggga
ttcatcagtaagaggggtagaagcacaatggaggaagtggctgaagggtatctacaggaa
ttggttaacaggaacatgctacaactaattgacaggaattcatttggcaggataaaatca
ttccggatgcatgatatcatgcatgagttggcggttgacttgtgccgaagagaatgtttt
ggcgttgcatatgatgaagataatagacgttgggaacatgaggatagagatgaacgccga
ttggtagtacacaaacttaataaggacattgatcaagaaatttcttgtgcgcatagtctt
cgatcagtcattacattggataatagtatgatatcatcatccagcatactatgtctagta
gtggacaattgcagatatatgtcaatactggagttaagtgggctacccatcagcacggtt
ccagatgctattggagatctattcaatctccgccatttaggtcttcgtggttcaaatgtg
aagtttctcccaaagtctatcgagaagctaaccaacctgttaacactagacctcttcaga
tctagcatactggagcttcctagaggcattgtcaagctgacaaagcttaggcacttgttt
gctgagaaacagactgatcgacatcggcgccttttcaggtggtgcactggtgtaagcatc
cccaggggccttgagaacttgacaagcctacaatccctacaagcactggaagctcaggat
gagtctgttagatgcttaggagagctcaggcagatgagaggtctcagattatggaaagtg
aaggcaagcctctgtgaacgcctctatgagtcgctgcttcagatgaaatgtttgtcctac
ctaagtatcacggcaagtgatgaggatgatgttctccagttggatggcttgaaccccctt
cctccaagccttcataaactacgtttaagtggacgattggcacacaccatgttgggtgca
gagtctcctctattccaagaagatgccgggggacgaaatctgtactcgttgcgcctattt
tggtcccaactaaaagaggatcccttgccatccctttctcggttgttaaatctaacagag
ctacatttcaccagagcctacaacggagagaagctggtcttccttactagatggtttccc
aagctgaaggttctacgtttaagagacttgcctaatctaaagaggatggatattcagcaa
ggtgccatggtgagccttgaaagattaagactaataaacctaagcagcatggaagaggtc
cctctaggcattgagtttctcatgcccctcaaatatctaagcttcgaggagatcactgtt
gacttcttactgtcattgcgccaatctagaattggtggtatgcgatggtggcacacttta
cgagaggagaatgatatggaagctggtgtaagaacgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326180
Entry
4326180           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1 isoform X1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4326180
SSDB
Motif
Pfam: NB-ARC Rx_N AAA_22 LRR_8 NTPase_1 AAA_14 AAA_16 AAA_24 OGG_N ATP_bind_1
Other DBs
NCBI-GeneID: 4326180
NCBI-ProteinID: XP_015620908
UniProt: A2ZU77 Q8RYR1
LinkDB
Position
1:20328276..20338017
AA seq 905 aa
MAEGVVGSLIGKLGAALAKEAATYGASLLCQEVSALKRLFAQIRDVKDELESMEAYLHGA
ERFKDIDETTGNYVKKIRGLAFEIEDAVDEFTYKLEDKHGGFTAKMKKRIKHVKAWRRLA
LKLQDIKQRLKNADERKIRYDLSGIEKNGHSKSPEQSFQFAREEDLVGIEINKELLMQWL
VGDSEQGCKIATVWGMGGVGKTTLVSQVYKTVKLDFDVSGFVTVTNSYQFDDLLKKISTE
FEIPIDADNIAVGSLVESIHHHLQGKRYILVLDDVWQPDVWFKLRNAFPTESTGRFIFTT
RMQEVALLATKKCTIELAPLDAHCSWQLFCKEAFWNADNKTCPEELQDIASMFVDKCAGL
PIAIACIGRLLSCKHPIYSEWEHVYKDLELQLTNNVILDVDIVLKVSLEDLQRNLKNCFL
HCTIFPESYAFNRKRLIRHWIAAGYIQEVGSKTVEEVAEGYLNELVNRSLLQVVERNLSG
RVRRCRMHDIIRLLALRKSKEEFFCQVYKGSEACSIENTRRLSIQNVSIQHLSGSSAPCL
RSLHVFSIYRRIDSLEAFLKSFKFLSTLDLQGISIKRLPKIVFDLFNLRFLGLRKTYIEY
LPKELSRLQNLEVLDAYDSKLLILPVEVATLWKLKYLYVVRVPEGSYDRVLAFDGLQVPM
GICNLIDLLALQLIEASTEVLRHIGCLTKLRTFAIGKVRNEHCADLCDAIMRMTCLVHIT
IISADEKEVLQLETLCLPSTIAKIDLGGRLSKESMSQLISTSSNLVNLTELNLCFSKLNE
DSFACILNLHNLVELYLSKAYDGKELIFHATSFPKLKLLAVWDAPYLRKVAIQQGALQSL
VRLWLADCPELRDVPDGIEHLRTLEHLRIKGSSDELWRKLEIKGKSNKRNEDRMKISHVK
WVEIV
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggcggagggcgttgtaggatcgctgatcggcaagcttggtgcggccttggcgaaagag
gcagcaacctacggcgcatcgctgctctgccaggaagtctctgctctcaagcgtctcttt
gcccagatccgggacgtcaaggacgagctggagagcatggaggcctacctccatggagct
gagcggttcaaggacatcgacgagactactggaaactatgtcaagaagatccgagggctg
gctttcgagatcgaggatgctgttgacgagttcacctacaagctggaggacaagcatggg
ggattcactgccaagatgaagaaaaggatcaagcatgtcaaggcatggcgtcgtctcgca
ctcaagctgcaagacatcaagcaaaggcttaaaaatgccgacgagaggaagatccgttat
gatctgagtgggattgaaaagaatggtcactctaaatcccctgaacaatcttttcagttt
gcgagggaagaggatcttgtggggattgagataaataaggagttgctgatgcagtggctt
gtgggtgattcggaacaagggtgtaaaattgcaacagtttgggggatgggaggtgtggga
aagaccactttggtttcccaggtgtacaagactgtgaaattggattttgatgtttctgga
ttcgtgactgtcacaaacagctaccagtttgatgatctattgaagaagatctccacagag
ttcgaaattccaatcgacgctgataacattgcagtgggaagcctagttgagagcattcat
caccatctgcaaggtaaaaggtacattttggttcttgacgatgtttggcaaccggatgtt
tggtttaagctaaggaatgcgtttcctactgaaagcactggtcggtttattttcactact
agaatgcaggaagtagcattgctagcaactaaaaaatgtacaattgagttagcaccgtta
gatgcacattgttcatggcagttgttctgcaaagaagcattttggaacgctgacaacaaa
acatgccctgaggaactacaagatatagcttcgatgtttgtagataagtgtgctggcttg
cccattgccattgcatgcataggccgcttattatcctgcaaacacccgatatactctgaa
tgggaacatgtgtacaaggacttagagcttcagctcaccaacaatgtgatccttgatgtt
gatattgttctgaaagtcagcttggaggatcttcaacgtaatttgaagaactgttttttg
cactgcacaatatttccagaaagttatgcattcaacagaaaaagattaatcagacattgg
atagcagctggatacattcaagaggtaggtagcaaaacagtagaggaagtggcagagggc
tacttaaatgaacttgtaaacagaagcctgttacaggtagttgagcgcaatctatctggt
cgagttcgcaggtgccgaatgcatgacataatccgtttacttgccctcagaaaatcgaag
gaggaatttttttgtcaagtttacaagggctctgaggcatgttcaatcgagaatacacgt
cgtttatcaatccaaaatgtaagtattcaacacctttctggatcaagtgcaccatgtctc
cgatccctccatgttttcagtatttatcggagaattgattcgctggaggctttcctcaaa
tcattcaagtttctgtcaacgttggatcttcaaggtatttcaatcaagaggctacctaag
attgtttttgacttgtttaatctacggttcttgggtcttcgcaaaacatatatcgagtat
ctcccaaaagaactgagtaggttacagaatttggaagtcctggatgcttatgattctaag
ctattgattcttccagtggaagtggccacactttggaaactgaaatatctatatgtggta
agagttccagagggatcttatgatagagttcttgcttttgacggcctccaagtgcctatg
ggtatctgtaatttgattgacttgctggccctgcaacttatcgaagctagcactgaggtt
ctgcgtcatattggatgtttaaccaagttaagaacctttgcaatcggtaaagttagaaat
gaacactgtgcagatttgtgcgacgcaatcatgagaatgacttgtcttgttcatattaca
atcatttcagctgatgagaaagaagtgctacagttagaaacactttgtttaccttctact
attgcaaagattgatctagggggcaggctaagcaaggaatccatgtcacagttgatctca
accagttcaaacctcgttaaccttactgaattaaacttgtgcttctccaaactcaatgaa
gactcttttgcttgcatcttgaatttacacaacttagttgagctttatctttcaaaggct
tatgacggaaaggaactaatcttccatgcaacatcatttccgaaactcaaattactagca
gtatgggatgctccttatctcagaaaagttgcaatccaacaaggtgcgctacaaagtctt
gttaggctatggctagctgattgtccagaattaagggatgttcctgatggcatcgagcat
ctgagaacccttgagcatctgagaattaagggaagttcagatgagctctggaggaagctt
gagataaaaggaaaatcgaacaaacgcaatgaagatagaatgaagatcagccatgtcaaa
tgggtcgaaattgtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336576
Entry
4336576           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1 isoform X1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4336576
SSDB
Motif
Pfam: NB-ARC Rx_N AAA_22 AAA_14 AAA_16 LRR_8 AAA_25 AAA_33 AAA_18 NACHT LRR_4 NTPase_1 CbiA
Other DBs
NCBI-GeneID: 4336576
NCBI-ProteinID: XP_015634134
UniProt: B9FGF8
LinkDB
Position
4:complement(27431489..27434736)
AA seq 951 aa
MAEMIAVTLSAKVAAALSGPAAVRLSSLAGVRSGIEAAARDLELLRAFLRFVDSLHGSDP
LADAWVDQVRDVAFDLEDAADEYAFLSGHGFFRHGANLGAWFALSRRLWRARERLRELSA
AKEQLGIRPAEVSASSSGGAGGLSAAMIGRKIAEASHFVEEGEIVGFAMHERLLMKWLTG
DTDPRQLLIAVCGMGGVGKTTLVTNVYKKVAATCHFDCAAWVAVSKSFTTDDLLRRIAKE
FHRDNRGCVPWDVDNMDYRSLVEALRGHLAKKRYLLLLDDVWDAHAWYEIRHAFVDDGTK
SRIIITTRSQDIASLASSNRIIRLEPLSEQEAWSLFCNTTFREDADRECPYYLRHWASKI
LDRCCGLPLAIVSVGNLLVLKDRTEFAWKSVYDSLVWYESSDHGIGQVSSILNLSFDDLP
YHLKKCFLYCSIYPEDFMIKRKILIRAWIAEGLIKEKGQGTMEEVADDYLNQLVQRSLLQ
AAVQNEFGRAKRCCIHDLIREMIVHRSTKERFFVFSKCTVTLKSSKKARHLVFDRCRSDR
LSAPKMNSLRSFHAFKADLDASLFSSFRLLTVLNLWFTPTAKLPSAVASLLNLRYLGIRS
TLIGELPEELGQLHNLQTLDAKWSMVQRLPQSITKLKNLRHLVLYRRRSADFTYPGPGTA
IALPDGLKNLTCLQTLKYIEADEKMVRSLGSLKHMRSLELCGVHESNLIHLPSSISKMTC
LLRLGIISQDANVKLDLEPFYPPPIKLQKLALAGMLVRGKLPSWFGSLNNLMQLRLHSSN
LMEDSLGLLSSLPRLLHLSLVNAYSGKSLTFANGYFPALKKLTLHDLPNLSHLEFQKGSL
VDLHVLMLGRCAQLNKLPQDIRNLVNLETMDLFEMPSEIIQNIQNNEILQEHNHESEHTI
VIKNIRWNNGKLLEEKVYINLSLLESRPFIDKEQHNVKSQAEITAGRTHNE
NT seq 2856 nt   +upstreamnt  +downstreamnt
atggcggagatgatcgccgtgacactctcggcgaaggtcgccgccgcgctgtccggaccc
gcggccgtcaggctctcctctctcgccggggttcgctcgggcatcgaagcggcggcgcga
gacctggagctcctccgcgccttcctccgcttcgtcgactccctccacggcagcgacccg
ctcgccgacgcctgggttgaccaggtgcgcgacgtcgccttcgacctggaggacgccgcg
gacgagtacgccttcctctccggccacggcttcttccgccatggcgctaacttgggcgcc
tggttcgcgctctccaggcgcctgtggagggcgcgggagaggctccgcgagctctcggcc
gcgaaggagcagctaggaatccggccggcggaggtctccgcctcgagctcgggtggcgct
ggtggcttgtctgcggcgatgatcggtcggaagatagcagaggcgtcgcacttcgtagag
gagggtgagatcgttggttttgcgatgcacgaaaggttactgatgaaatggctgactggg
gatactgacccccggcagctgctgatcgcagtctgcggcatgggcggcgttggcaagaca
actcttgtcacaaacgtgtacaagaaagtcgctgcaacctgccactttgattgcgctgcg
tgggtggctgtctccaagagcttcacaacagacgacctccttagaagaattgccaaggaa
tttcatcgggataaccgcggctgcgtgccgtgggacgtggacaatatggactaccgctcg
ctggttgaggctttgcgtgggcatctcgccaagaagaggtacttgcttttgctggatgat
gtctgggatgcccatgcgtggtatgagatccgtcatgcttttgttgacgatggaaccaag
agccggataatcatcactacacgcagtcaggacattgcttctctggcatcatcgaatagg
atcatcagactggagccactttctgagcaggaagcatggtctttgttttgcaacaccacg
ttcagggaagatgcagaccgagaatgcccatattatctgaggcattgggcttcaaagatt
ctggacagatgctgtggcctgccattggcaattgtttctgttggtaatctgcttgttttg
aaggatagaacagagtttgcctggaaaagtgtatatgacagccttgtgtggtatgaaagc
agtgatcatggaattgggcaggtgtcaagcatactgaatctgagcttcgatgatctgcct
taccacttgaagaaatgttttctgtattgcagtatataccctgaggattttatgataaag
aggaagattctaatcagagcatggattgcagaaggtttaatcaaggaaaagggacagggc
acaatggaggaggttgcggatgattaccttaaccagttagtgcaacgttccctgttgcag
gctgctgtccagaatgagtttggacgtgcaaagcgctgttgcattcatgacctgatcagg
gaaatgatagtgcacagatcaacaaaggaaagattctttgtgttctctaaatgcactgta
acattgaagtcaagcaaaaaagcccgtcatcttgtatttgaccgatgcagaagtgatcgt
ttgtcagctcccaaaatgaactcgcttcgctccttccatgcatttaaggcagatttggac
gcctcactcttctctagctttaggttattgactgtgttgaacttatggttcactccaaca
gctaaactgcctagtgcggtggccagtcttcttaatttgcggtatcttggcatccgttcc
actctcatcggtgagcttccagaggagttgggacaattacataacttacaaactttagat
gctaagtggtccatggtacagagattaccacaaagcataacaaagctcaagaacctgcgc
cacttggttttgtatagacgccgatctgcagatttcacctatccaggccctggtacggca
attgcgcttcctgatgggctgaaaaatctgacctgcctgcagactcttaaatacattgaa
gctgatgagaagatggttagatccttaggaagcttaaagcacatgaggagcctagagcta
tgtggtgtgcatgagagcaatcttattcatttgccctcgtccatctccaaaatgacttgc
ctactgcgcttgggaattatcagtcaggatgctaatgtaaaattagacctggaaccattc
tatcctccaccaataaagctacaaaaacttgccttagcggggatgttagtaagaggtaag
ttaccttcttggtttggctcccttaataacctcatgcagttgcgattgcattcatctaac
ctcatggaagattcacttggattgctctcatcgcttccccggttgttgcatcttagcctt
gtcaatgcatacagtgggaagagtttgacctttgcaaatggttattttccagcccttaag
aaactaactttgcacgacttgcctaacctttctcacctggagtttcagaaggggagtctt
gtagatctacatgtgttgatgcttggccgatgtgctcagctaaataaactaccccaagac
atcaggaacctggtaaatcttgaaaccatggatctttttgaaatgccaagtgagataata
cagaatatacagaacaatgagatattacaggaacataatcatgagtctgagcacacaata
gtaatcaagaacatccgttggaataatgggaaattgttggaggaaaaagtttatatcaac
ctatcactattggaaagtaggcccttcatagataaagagcagcataatgtaaagtcccaa
gctgaaattactgcaggtagaacacacaatgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340191
Entry
4340191           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4340191
SSDB
Motif
Pfam: NB-ARC Rx_N AAA_22 LRR_8 AAA_14 NACHT AAA_16 DUF3081 LRR_4
Other DBs
NCBI-GeneID: 4340191
NCBI-ProteinID: XP_015644533
UniProt: Q0DEE3 B7ESA2
LinkDB
Position
6:complement(2985080..2990998)
AA seq 954 aa
MEGAIFSVAEGTVRSLLSKLSSLLSQESWFVRGVHGDIQYIKDELESMNAFLRYLTVLED
HDTQVRIWMKQVREIAYDAEDCIDQFTHHLGESSGIGFLYRLIYILGKLCCRHRIAMQLQ
ELKARAQDVSERRSRYEVMLPKTTLQGAGPRLTRHASRHLDPQLHALFTEEAQLVGLDEP
RDKLVRWVMEADPCRRVLAIVGFGGLGKTTLARMVCENPMVKGADFHCCPLFIVSQTFNI
RTLFQYMIRELIQRPNKAMAVAGGKHGHTMDGNMDGMERWEVAVLAEKVRQYLLDKRYIV
IFDDIWTISAWESIRCALPDNKKGSRVIITTRNEDVANTCCSGPQDQVYKMQRLSDAASR
ELFFKRIFGSADISSNEELDEVSNSILKKCGGLPLAIVSIGSLVASKTNRTKEEWQKICD
NLGSELETNPTLEVAKQVLTLSYNDLPYHLKACFLYLSIFPENYVIRRGPLVRRWIAEGF
VNQRHGLSMEEVAESYFDEFVARSIVQPVKIDWSGKVRTCRVHDMMLEVIISKSLEENFA
SFLCDNGHPLVCHDKIRRLSIHNSHNSVQRTRVSVSHVRSFTMSASVEEVPMFFPQMRLL
RVLDLQGSSCLNNSTLNYICKFYQLKYLTLRKTNIGKLPRLIGNLKYLETLDIRATRIKR
LPASASNLSCLKHLLVGHKVQLTRTTSVKCFRPDSGLEMTAGVVKNMMALQSLAHIVVKE
RPAVLSEIGQLQKLQKLNVLFRGVEENWNAFLQSLVKLTGSLRSLSIHILDEKEHSSSLE
YLALIAESPPLFIRNFSLKGKLQRLPPWIPSLRNVSRITFRDTGLHAEAIGVLGDLPNLL
CLKLYQRSYADDHIFFAHGNFLKLRMLVIDNMENIRNVHFEKGSVPNLEWLTIAFLQEPK
DGITGLENLLKLKEIEFFGDIILSMVTKVASCMKAHPNRPRVIGDKWNNVTEYA
NT seq 2865 nt   +upstreamnt  +downstreamnt
atggagggtgctatttttagtgtggctgagggcactgttaggagcctcctgtccaagctt
agctcccttctctcccaggagagttggttcgtgcggggtgtccatggtgacatacaatac
ataaaagatgagctcgagagcatgaatgcattcctccggtacctcactgtgttggaggac
catgacacccaagtgagaatctggatgaagcaggtgagggagattgcctatgatgccgag
gactgcattgaccagttcactcatcatcttggtgagtcatcaggaattggtttcctttat
cggctaatctatattcttggcaaactatgctgtcgccatcgaatcgccatgcagctacaa
gagctaaaggcccgtgcacaggatgtcagtgagcggcgttcacgctatgaggtgatgctg
ccaaagaccacacttcaaggagcaggcccacggcttaccaggcatgcatctcgtcatctt
gatccgcagttgcatgctctcttcactgaggaggcacagctggtgggccttgatgaacca
agggataaacttgtccgctgggtaatggaagcggatccttgccggcgtgtgcttgccata
gttggttttggcggccttgggaagaccacactggcaaggatggtgtgtgagaacccaatg
gtgaagggtgctgattttcactgctgtccattgttcattgtgtcacagacattcaatatc
aggactctgttccagtacatgataagggaactgatccagcgtccgaacaaggcaatggct
gtagcaggaggtaagcacggtcatacaatggacggcaacatggatggaatggaaagatgg
gaagttgcagtgctggctgaaaaagttaggcagtatttgctagacaaaaggtatattgtc
atctttgacgacatatggaccatatcagcttgggagagtatcagatgtgcattgcctgac
aataagaagggcagcagagtaattataaccacacggaatgaagatgtggctaacacatgt
tgttcaggtccccaagatcaggtttacaaaatgcagcgtctatcagatgctgcatcacga
gaactattcttcaagaggatatttggttctgcagatatatcatcaaatgaagagttggat
gaagtctcgaattccattttgaagaaatgtggaggcttgcctttagcaatagtgagtatc
ggcagccttgttgcgagcaagacaaataggaccaaggaagagtggcagaagatttgtgac
aacttgggctctgaacttgaaactaatcctaccctggaagttgcaaagcaagtgttaacc
ctgagctataatgatctaccttaccatctgaaggcctgcttcttgtatctaagtattttt
cctgaaaattatgtgatcaggagggggcctttggtgaggaggtggatagccgaaggtttt
gtcaaccaaaggcatggactaagcatggaagaggttgccgaaagttactttgatgaattt
gtggccaggagtattgtacaacctgtgaaaattgattggagtggcaaggtgaggacttgc
agagttcatgacatgatgctagaagtcatcatctccaagtcgctcgaggagaactttgca
tccttcttgtgtgataatggacatccattggtttgccatgataaaatccgtcgtctctcc
atccataacagtcacaattcggtgcaaagaacaagagtcagcgtatctcatgttcgctcc
tttacaatgtcagcttccgttgaggaagttccaatgttctttccacagatgcggctgcta
agagtactagacttgcaaggttccagctgtctgaacaacagtactctgaactatatctgt
aaattttaccagctgaagtatctgacactcagaaagaccaatattggcaaattaccacga
ctaattggaaatctgaaatacctggagacactggacattagggcaacgcgtatcaagaga
ttaccagccagtgcaagcaacctcagttgtctcaagcatttgttagttgggcacaaggta
caacttacaaggacaaccagcgtgaagtgcttccgaccggactcaggcttggagatgacg
gctggggtggttaagaacatgatggctctgcaatcacttgcccatatagtggtcaaggag
cggccagcggtgctgagtgaaattggccagctccaaaagttacagaaacttaatgtcttg
tttcgcggtgtggaagagaactggaacgcattccttcagtctctggtaaaattgactgga
tctcttcgctcgctctccattcacattctggatgagaaagagcacagctcatcactggaa
tatctagctcttatcgcagagtcgcctcctctattcatcagaaattttagcctgaaaggc
aagttgcagaggcttcctccttggataccatcacttcgaaatgtgtccaggattactttt
cgtgacactggactccacgctgaggccattggagttcttggagacctgcccaatctgctc
tgtctcaagctctaccaaaggtcctacgctgatgaccatatattttttgctcatggtaat
tttttgaagctcagaatgttggttattgataatatggagaacattcgcaatgtgcacttc
gagaagggctcagtccctaaccttgagtggctgacaatagcattcctgcaagaacccaag
gatgggattacaggtctggagaatctgctgaagctgaaggagatagagttctttggcgac
atcatattatccatggtgactaaagtggcatcctgcatgaaggcacatccaaatcgcccg
agagtgataggtgacaaatggaacaatgtgacggagtacgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342596
Entry
4342596           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4342596
SSDB
Motif
Pfam: NB-ARC Rx_N LRR_8 LRR_4 AAA_22 AAA_16 AAA_33 AAA_14 Sigma54_activat
Other DBs
NCBI-GeneID: 4342596
NCBI-ProteinID: XP_015645210
UniProt: A0A0N7KN18
LinkDB
Position
7:4618627..4622750
AA seq 906 aa
MVEALVIAVVQKISSALAEEGSKILASKLKKQAPDLLEVTNKMRLLQSDFSMLQAFIAQV
AVDRSNDMVLEAWMEQVRLAAHEAEDIVDEYTYLVGQTEGTGSFLKKAFNQAIEVKKWRK
LSAQAKLVEDRLQKISEAKNRFDISFASSGRENTASYPSRHHHLSEYSYLNDDDDLVGNA
EEMKRLIEWLCDAKKDRSVISICGMGGLGKTTLASSIYKKEEIKRTFICRAWITVSQNHG
VKNLLKKILVQLMSKTENIMDGADTMDCVSLVEQLQRYLKGRRYLIVLDDVWSREAWPLL
DNAFVKNNNGSRVVITTRIETVASLADANYELKLTLLPKQEAWTLFCQKAFSRLDDRSCP
HNLKTVAERIVEKCQGLPLALVAIGSLLSYKEMDEHEWELFYNQLRWQLSNNPELSWVAS
VLNLSYNDLPSYLKNCFLYCGLFPEDYRIERKRLIRLWIAEGFVQDRGPETTLTDVAACY
LKELASRSLLQVVNRNEYGRPKRFQMHDLVREISLTISKKEKFATTWDCPNSDGVTDGSR
RVSLQKDGNLVQAAKCSSQLRSMLMFTEEISLSWFTDCYQSFRLLRVLCLRNCNVHKVPD
SVSQLFNLHYLDLGYTKLKEIPSSIGKLSNLQTLYLNGSVLELPSETTMLTKLHHLLIDV
GRFGKSASSKISCLEHLQTLRSIEANSYIVKNLGCLTRMRSVGIMKVLESHNTDLWTSIS
KMTSLNSLSVLAEDRDRYALDLGNLKPLSHLEKLMISGRLHKGAIPPVFASFTKLRSLSL
CFSGLHEDPLASFAAMFQNLGHLNLYRCFDGAKLTFRAGWFPNLKHLYLSSMNELREVEV
EDGAMRSLWRLELWSLKSLTSVPQGFVHLRSLQQLCIGSLMPEEFHRRLEGIDRWIVRHI
PYIGDP
NT seq 2721 nt   +upstreamnt  +downstreamnt
atggtagaagctttggtcatagcagttgttcaaaagatttcatcggcacttgcagaagaa
ggatcgaagatacttgcttctaagttgaagaagcaagcacctgaccttcttgaagtaacc
aataaaatgagactacttcaaagcgacttctcaatgttgcaagcattcatagctcaagtg
gctgtggacaggtccaatgatatggtacttgaggcctggatggaacaggtaaggctagca
gcgcatgaagctgaggacattgtcgatgaatacacttatcttgttggccaaacggaaggg
actggcagtttcctaaagaaagcattcaaccaagcaatcgaagttaagaaatggcgcaag
ctttcagctcaggcaaaactagtagaggatcgtctacaaaagatttctgaagcgaaaaat
agatttgatatctcatttgcaagcagtggaagagagaatacagcgagttatccaagtagg
caccatcatttatctgaatattcatacttgaatgatgatgatgatttagttggtaatgca
gaagagatgaagcgattaatagaatggttatgtgatgcaaaaaaagatcgcagtgtaatc
tccatatgtggaatgggagggttgggcaagacaactcttgctagtagcatttacaagaag
gaagaaattaaaagaacatttatttgccgtgcatggatcactgtctcacaaaatcacggt
gttaaaaatctcctgaaaaagatcttagtccaactcatgagcaaaactgaaaatattatg
gatggggctgataccatggattgtgtgagtcttgtggaacaacttcaaagatatctaaaa
gggaggagatacttaattgttctggatgatgtatggagtagggaggcctggcctttacta
gataatgcatttgttaagaacaacaatggcagccgagtagttatcacaactcgaatcgaa
acggtagcatctctagcagatgcaaactatgaactgaagcttacacttctaccaaagcag
gaagcctggactcttttctgtcaaaaggctttctcaagattagatgacagaagttgcccc
cataatctgaagaccgtcgctgaaagaatcgtggagaaatgccaaggtttgccactggct
cttgtagctatagggagccttttatcgtacaaagaaatggatgagcatgagtgggagttg
ttctataatcaacttaggtggcagctcagtaacaatccagagctgagctgggtcgctagt
gttctgaatctcagttacaatgatctccctagttatctaaagaattgctttctttactgc
ggcctgttccctgaagattatcgaattgagagaaaacggttaatcagattgtggatagcc
gaaggatttgttcaggatagaggacctgagacaacattgacagatgtagctgcatgttac
ctgaaggaacttgctagtcgatcattgcttcaggttgtgaataggaatgaatatggaagg
ccaaagagattccagatgcatgatcttgttagggaaatatccctaaccatatctaagaag
gaaaaatttgctactacatgggactgtcctaactcagatggagttaccgatggatcacgg
cgtgtttctttacaaaaggatggcaatttagtccaagcagcaaaatgttcatctcagctt
cggtccatgctcatgtttacagaggaaatatcgttgtcttggttcacagattgctaccaa
agctttagattgctaagggtcttgtgcctgagaaattgcaatgttcacaaggtaccagat
tctgtttctcagctgtttaacttgcactacctagacttgggatacacaaaactgaaagag
ataccgagttcgatagggaagcttagcaatctgcaaacgctttatctcaatggttctgtg
ctggagttacccagtgagaccacaatgttaactaagcttcaccatctacttatagatgtc
gggcggtttgggaagtcagcgagtagcaaaataagttgcctggaacatctacagactctg
agaagcatagaagccaatagctacatagtgaaaaaccttggatgcttgacaaggatgaga
agtgtcggtatcatgaaggtgctggagtcccacaacactgatctatggacctcaatcagc
aagatgacatctctgaattcattgtctgttctcgcagaagatcgtgatcgatacgccctt
gatctcggcaacttaaaacctttatctcacctggagaagctgatgataagtggcaggcta
cacaaaggagcaattcctcccgtttttgccagcttcaccaaactgagaagcttgagcctc
tgcttctctggtcttcatgaagatccgctcgcttcttttgctgccatgttccagaatcta
ggccatcttaacctttaccggtgcttcgacggggcgaaactgacatttcgcgctggatgg
ttccctaacctgaaacacctgtacctgagctccatgaatgagctcagggaggttgaggtt
gaggatggcgccatgagaagcttgtggagacttgagctttggagcttgaaaagcttaaca
tctgtgccacagggctttgtgcatcttaggtcactccagcagctgtgcattggatcattg
atgcctgaagagttccacaggaggttagagggaatcgatcggtggattgttcggcacatc
ccctacatcggagacccgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345108
Entry
4345108           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1 isoform X1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4345108
SSDB
Motif
Pfam: NB-ARC Rx_N LRR_8 LRR_4 AAA_16 AAA_14 AAA_22
Other DBs
NCBI-GeneID: 4345108
NCBI-ProteinID: XP_015650937
UniProt: Q0J6V9 Q6Z5Z6
LinkDB
Position
8:9824563..9830748
AA seq 779 aa
MSTWQLASYKDPLFPSCWKKRSKSPNQPAKVCRISSLIKQRSDKRMAETAILLAIKKISI
AVAGEMLSLSRPIIAKKSELVVALPTNMELVKDELEIINAFLKKVKTRDCRDNVLETWIT
QVRRLAYDIEDIVDQFIYVVGEHQGKGFWGNLKKFVKKPESLFSLDRVATEVEKVKLKLK
ELSSRRDRWVQSTICRPDAEIPNYDDEQGVYQFRHSQVPDYDDNELVGVDEYRETLTKLL
YSEHCSLRIVAVCGMGGLGKSCLVYNVFKRERSHFDCSSWISVSQSCKMDDIFRNMLNQL
LGDSSEVNYDTSRMGIEVLKEELKRFLEDKSYIIALDDIWRAPVLLEIRDTLFNSGKGSR
LIITTRIDEVAAIAEDACKINLEPLSKYDAWILFCRKVFWKTENHACSPELQKWGEKIVN
KCEGLPLAIVALGSLLSLRDKTEAVWKCFHSQIIWELQNNPDISHVEWILNLSYRHLPNH
LQNCFLYCAMFPEDHLLRRKKLIRLWIAEGFVEQRGSISLEEVAESYLIELVHRSMLQVV
ERNSFGRIRRFRMHDLVRELAIKMSEKESFSSLHDDTSGVVQVVSDSRRVSLIRCKSEIT
SNLASSRLHTFLVFDTTMLQCSWSCFVPPKSKYLAVLDLSGLPIEAISNSIGELFNLKYL
CLNDTNLKSLPKTITRLHNLGTLSLERTQVTSFPEGFAKLKKLRHVLVWKLLYNEHSSFS
NSLGMGTIEGLWNLKELLTLDEIRANKKFVSRLGYLAQLRSLYISDVRSNYCSELCSSL
NT seq 2340 nt   +upstreamnt  +downstreamnt
atgagcacttggcagttggcaagttacaaggatcctcttttcccttcttgctggaaaaaa
cgatccaaaagtccaaatcaaccagccaaagtttgcaggatttccagtttgatcaagcaa
cggagtgacaagagaatggcagagactgcaattcttctagccataaagaagataagtata
gctgtggcaggagaaatgttaagcctgtcaagacccattattgcaaaaaaatctgaacta
gtcgtagcacttccgactaacatggaattggtgaaggatgaacttgagattataaatgca
tttctcaagaaagttaaaactcgggattgccgtgataatgtcttggaaacttggataacc
caagtcaggaggttggcatatgacattgaagatattgtggatcagttcatatatgttgtt
ggtgaacaccagggtaagggattctggggtaatttaaagaaatttgtcaagaaaccagag
tctttgttttcattggatagggttgctactgaggttgaaaaggtaaaactgaagctcaag
gaactgtcaagtaggagagaccgctgggtacaatcaacgatttgcagacccgatgctgag
ataccaaactatgacgatgaacaaggagtgtaccaattcaggcatagccaagtaccagat
tatgacgacaatgagcttgtaggtgttgatgaatacagagaaaccctcacaaagctattg
tactctgaacattgttctctgcgcattgttgctgtttgtggtatgggtggcttgggcaaa
agttgtcttgtttacaatgtcttcaagagagagcggtctcattttgattgctcttcatgg
atttctgtatcacagtcatgcaaaatggatgatatcttcagaaatatgttgaatcaacta
cttggcgacagcagcgaagtaaactacgacacatcaaggatgggcattgaggtattgaaa
gaagagttgaagagatttctggaggacaagagttacataattgcattagatgatatatgg
agagctccagttcttttggaaattagagataccctttttaatagtggcaagggaagtaga
ttaatcattacaactagaatcgatgaagtagctgcaattgctgaagatgcctgcaagatc
aaccttgagcctctaagcaagtatgatgcatggattttattttgcagaaaggtattctgg
aaaacagaaaatcatgcttgctccccggaattgcagaagtggggtgaaaagatagtcaat
aaatgtgaaggtttgccattagctattgttgcattggggagcttactatcactaagagat
aaaacagaggcagtttggaaatgtttccatagccaaataatttgggagttgcagaacaat
ccagacataagtcatgtggagtggatcttgaatttaagttacaggcatctgccaaatcat
ttgcagaactgtttcttatactgtgcgatgttcccggaagatcatctccttcggaggaag
aagctgatcagattgtggatcgcagaaggatttgttgaacaaagaggatcaatcagctta
gaggaggttgctgaaagttatctcatagaactcgtccatcggagcatgcttcaagtggta
gagaggaacagttttggcaggattcgacgtttccggatgcatgatcttgtacgtgaacta
gccattaaaatgtccgaaaaagagagtttcagttcacttcatgatgatacttctggagtt
gtacaggtagtgtcagattctcgtcgtgtgtcgctgatccgatgcaagagtgaaatcaca
tcaaacctagcttcatcgaggcttcacacttttttggtttttgacacaaccatgcttcaa
tgttcatggtcttgttttgttccacccaaatctaaatatcttgcagtgctggacttgtca
ggcttgcccattgaggctatcagcaattcgattggggaattgttcaatcttaaatatttg
tgcctcaatgatactaacctgaagtcactcccaaaaactatcaccagacttcacaattta
gggaccttaagtcttgaaaggactcaggtaacaagttttccagaggggtttgcaaaattg
aagaaactgaggcatgtacttgtctggaaattactgtacaatgagcactcaagtttcagt
aactccttgggtatgggaacaattgaaggtctttggaatttgaaggaattgcttactttg
gatgaaattcgggcaaataaaaaatttgtcagtaggctagggtatttggcccaactaagg
agcctttacatttcggacgtaaggagtaactattgctcagaattgtgttcttcactataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347381
Entry
4347381           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPM1
  KO
K13457  disease resistance protein RPM1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4347381
SSDB
Motif
Pfam: NB-ARC Rx_N AAA_14 AAA_16 LRR_4 AAA_22 RsgA_GTPase LRR_8 DUF815 MMR_HSR1 CDH1_2_SANT_HL1
Other DBs
NCBI-GeneID: 4347381
NCBI-ProteinID: XP_015610756
UniProt: Q0J0X1 Q652D6
LinkDB
Position
9:complement(18391857..18397896)
AA seq 960 aa
MAEIIVLFVIKKIGIAVAGETLKLAKPLLANKTELKKAELVTALPVNMKLIKDELEVINA
FLKELGMNGCKGEVVETWVRQVRRLAHDMEDVVDEFMYVIGKNKERESRAYVKKIIKKPK
PLFSLDEIATKADRINRQLMELSKRLGRWTQPILSGGSIPATKYDTEQQQLYLPGHDYSI
TDAELVGIDKNRQTLIESLCLEDCSLRIIAVWGMGGLGKSTLVNNVYKKEATVSNFNYRA
WLSISQSCRVLDIWRNMLKELCGKESREFDAENMSSTELKVELTKILDQKRYLIILDDVW
LATDFLKIREVLVDNGLGSRVIITTRIEEVASIAENGCKISLEPLDNHDAWLLFCRKAFP
KIEDHICPPELEQCGMDIIDKCDGLPLALVAIGSLLSFKSKNNKDWRLFYNQLISEVHNN
ENLNRVEKILNLSYKHLPNHLKYCFLYCAMFPEDYLIHRKRLIRLWISEGFIEQKGACSL
EDVAEGYLAELVQRSMLQVVACNSFDRVQCLRMHDIVRELAIFQLKKESFCTIYDDTHGV
AQVGLDSRRVSVLRCNNDIRSSIDPSRLHTFIAFDTTMALSSWSSFIFSESKYLNVLDLS
GLPIETIPYSVGELFNLRFLCLNDTNVKEFPKSVTKLSNLQTLSLERTQLLNFPRGFSNL
KKLRHLLVWKLVDATYKSLNNWESMEPFEGLWDLKELHYLNEVRATKAFVSNLGNLSQLR
SLCITYVRSSHCVQLCNSLSKMQHLTRLNIRARNEDELLLLDDFTLSNPLEKLELVGQLS
EGTLESPFFSIHGYKLLQIELSWCKLTVNPVARLAEFSDLTELRLTRVYTGPWLYFPANW
FPKLKKAVLWDLQQVKQIFIQEGALANLHYLHIDSLMELRDIPVGIEFLSSVKEAYFTRM
HSDFVRNLRTGKISHIPKVHWSTQGVSTDLTGLANLPGASNMTNTNPEWRILGGSGWVFI
NT seq 2883 nt   +upstreamnt  +downstreamnt
atggcagaaattatcgttctttttgtcataaaaaagataggaatagctgtggcaggtgaa
acactgaagctagctaaacccttgcttgcaaacaaaaccgagttaaagaaagctgagcta
gtaacagcacttccagttaacatgaaactgataaaagatgaacttgaggttatcaatgca
tttctgaaggaacttggcatgaatggatgcaaaggtgaagttgtagaaacttgggtaagg
caagtacggaggttggcgcatgatatggaagatgttgtggatgagtttatgtatgttatt
ggcaaaaacaaagagagagagtcacgagcttatgtgaagaaaattatcaagaaacctaaa
cctttattttcacttgatgaaattgctactaaagcagataggataaacagacagcttatg
gagctttctaaaagactaggacgttggacccaaccgatattgagtgggggtagtattcct
gcaacaaaatatgacactgaacaacaacagttgtatctacctggacatgattattcaatt
actgatgctgagcttgtaggaattgataaaaatagacaaaccttgattgaatcattgtgt
ttggaagattgttctcttcggatcattgctgtctggggcatgggtggccttgggaaaagc
actcttgtcaacaatgtctacaaaaaagaagcaacagtatccaatttcaattaccgtgca
tggctttctatctctcagtcatgtagagtacttgatatttggcgaaacatgctgaaagag
ctctgtggaaaagaaagcagagagtttgatgctgaaaatatgagcagtacagaactaaaa
gtggaattaactaaaattctggatcaaaagcggtacttgatcatattggatgatgtctgg
ttggctacagattttttaaagattagagaggttcttgttgataatggcctaggaagcaga
gtaataatcacaacaagaattgaggaagttgcttccatagctgagaatggttgtaagatc
agtttagagcctctagataaccatgatgcatggcttctcttctgtaggaaagcatttcca
aaaattgaagatcatatatgccctccagaattagagcagtgtggtatggacattatcgat
aaatgtgacggtttgcctttagctcttgtggcaatagggagtttattgtccttcaaatca
aagaataataaagattggaggcttttctacaatcaacttatttcagaggtacacaataat
gagaacttaaaccgggtggagaaaattctaaatctaagctacaagcacctgccaaaccat
ctgaagtattgtttcttatattgtgctatgttcccagaagattatctgattcacagaaag
agattaattagactgtggatcagtgaaggatttatagaacaaaaaggagcatgcagctta
gaagatgtcgctgaaggttacctagcagagcttgtccaacgaagcatgcttcaagttgta
gcatgtaacagttttgatagggttcagtgtcttcgaatgcatgacattgtgcgtgaatta
gccattttccaattgaagaaagaaagtttctgtacaatttatgatgacactcatggagtg
gcacaagtgggattagactctcgtcgtgtctcggtgcttcgatgcaacaatgatattaga
tcaagcatagatccatccaggcttcacaccttcatagcatttgacaccaccatggcatta
tcttcatggtcttctttcattttctcagaatctaagtaccttaatgtattagacttgtca
ggcttgcctattgagactattccatattcagttggggagctgtttaaccttcggtttttg
tgtctcaacgacaccaatgtgaaggaattcccaaaatctgttacgaagcttagcaattta
caaacattgagccttgaacgtacccagttgttgaatttcccacgagggttttcaaatcta
aagaaattgcgccatctgcttgtttggaagttagtagatgctacatacaaaagtctgaat
aactgggaatctatggagccatttgagggcttgtgggacttgaaggaattgcattatttg
aatgaggttcgtgcaactaaagcctttgtttcaaatctaggaaatttatcccagctgagg
agcctctgcattacttatgtaaggagtagtcactgtgtgcaattgtgcaactctttatca
aagatgcaacatctcacaagattaaacataagagcacgcaatgaagatgagctgctcttg
ctggatgatttcacattgtcaaaccctctcgaaaagcttgaactggtaggccagttgtca
gaaggaaccttggaatctccctttttctctattcatggatataaactcctgcaaattgaa
ctttcatggtgtaagctcacagtgaatccagtggcccgccttgcagagttctcggattta
accgagttacgtcttacaagggtgtacactgggccttggctgtactttcctgcaaactgg
ttcccgaaattaaagaaagccgtcttgtgggatttgcagcaagtgaagcaaatatttata
caggagggagctctggccaacctgcattatcttcacatcgatagcctcatggaactacgt
gacatccctgtcggtattgagtttctcagttcagtgaaagaggcatattttaccaggatg
cattctgattttgtaaggaatttacgaacaggaaagataagccatatcccgaaggtccac
tggtcaacacaaggggtgtccacggatctcactggacttgctaatctgcctggagcatcc
aacatgaccaacacaaacccagaatggcgcatcttaggtggatcaggctgggttttcatc
taa

DBGET integrated database retrieval system