KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276219
Entry
107276219         CDS       T01015                                 
Name
(RefSeq) serine decarboxylase 3-like
  KO
K25193  serine decarboxylase [EC:4.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107276219
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.-
     107276219
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5 RHD_DNA_bind
Other DBs
NCBI-GeneID: 107276219
NCBI-ProteinID: XP_015616246
LinkDB
Position
11:16353477..16357597
AA seq 631 aa
MAGLTGLQRRFDERAAKGDVKASSSSSKVNRRHYLPHGTEPNPRWMPKDLTATQKRRLQC
LQAQELREKKAEKQRDKRFNELRPPPVWRPKSIEKAKPIDVEEKEEQSVDKGKSSPKEDM
DINMVCMLHMEFCAIDEAEVTQFSLGPKDAVFEKPDESNRHMKPLYLNGHVDGKPLLCYI
SLMEASKISCLQVDEQLDSVQFYLTNVVERYVIDEPPEDAQAVLKRQHGIDNLLGHFRQH
LQERSAHHLGHPLSQKLDVGPLAQFQHFHINNIGDPFVESNYGIHSRQFEYAVLDWFAHL
WEIPKDQYWGYVTNGGSEGNYDGLLVGRELYPEGIIYASQDSHYSIFKAAKMYRVQCIKI
DTSFSGEMRYDHFRTKLLENARRPAIVNVNIGTTVKGAIDDLDEIISTLENCGFRDRFYI
HCDGALAGLMLPFIKQAPKVTFIKPIGSISVSGHKLLGCPTPCGVVINRLKDIDVLKSTN
IEYIASNDVTISGSRNGQSPIFLWYKLKSMGYEGIQREIEACLRNACYLTVRLRNVGISA
FMNSKSIIVIFEKPKDEMFMQKWQLACAGNVAHVVVMPHVSFEMLGIFVEELAEKRYALL
QNKEFSVPCVAMDIGQENCLCKLHENIRSSL
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggccggtctgaccgggctccagcgccggtttgatgaaagagctgcaaagggcgatgtg
aaggcttcatcgtcttcaagcaaggttaatagacgacattatttacctcatggaacagag
ccgaatcctaggtggatgcctaaggatttgacggctactcaaaagagaaggttgcaatgt
cttcaggcccaagaactaagggagaaaaaggccgaaaaacaaagagataaaaggttcaat
gagttacgaccaccaccagtatggaggcctaaatccatagagaaggcaaaaccgattgat
gtagaggagaaggaagaacaatcggttgacaaaggtaaatcgtctccaaaggaagacatg
gatatcaacatggtgtgtatgttgcatatggagttttgtgctatagatgaagccgaggtt
actcaattctcattaggtcctaaagatgcggtttttgagaagcccgatgaatcaaatcgt
cacatgaagcctctctatctcaatggccatgttgatgggaagccgttactgtgttatata
tctctgatggaagcatcaaagattagctgcctacaggtagatgagcagcttgattcagtc
caattttacctgacaaatgttgtcgagagatatgtgatagatgagcctccagaagatgct
caggcagtcttgaagaggcagcacggtattgacaacctcttaggacatttcaggcaacac
ctccaggagaggtcagctcatcatcttggtcatccacttagccaaaaattggatgttggc
cctctcgcacaatttcaacacttccacattaacaatattggagatccttttgttgagagc
aactatggtatccactccagacagttcgaatatgcagtgttggattggtttgcacatttg
tgggagatccccaaggaccagtattggggatatgtcacaaatggtggaagtgaagggaac
tatgatgggctcttagttgggagagagctgtatcctgaaggaataatctatgcatcacag
gactcacattactctatcttcaaggccgcaaaaatgtatagagtccagtgcatcaagatt
gacacctccttttcaggagagatgagatatgatcatttcagaactaaactactcgaaaac
gctaggagacctgcaattgtgaatgtcaatattggtactaccgtcaaaggggcaattgat
gaccttgatgagattataagcacgcttgaaaactgtggatttcgagatagattttatatc
cactgtgacggtgctctagctggtctcatgctgccctttatcaaacaggctccaaaggta
acattcataaagccaataggaagcatcagcgtctcaggccataagttattgggctgccca
acaccatgtggtgtggtaattaataggttgaaagacattgatgtcttaaagtccacaaat
attgagtacattgcttcaaatgatgtcaccatatctggaagccgaaacggtcaatcccca
atcttcctatggtataaactgaaaagtatgggatacgagggtattcagagagaaattgaa
gcatgcttaagaaatgcatgttaccttacagttcgtctcagaaatgtaggtattagtgca
tttatgaactcaaaaagtatcatagttatattcgagaagcccaaagatgagatgttcatg
caaaagtggcagcttgcatgtgcaggaaatgtagctcatgttgtggtaatgccacatgtg
agctttgaaatgcttggcatatttgttgaggagcttgcagagaaacggtatgcgttgctt
cagaataaagaattcagtgttccttgtgttgcaatggatataggccaagagaattgtcta
tgcaagctccatgaaaacattagatccagcttatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280579
Entry
107280579         CDS       T01015                                 
Name
(RefSeq) serine decarboxylase 3
  KO
K25193  serine decarboxylase [EC:4.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107280579
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.-
     107280579
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_1_2
Other DBs
NCBI-GeneID: 107280579
NCBI-ProteinID: XP_015634682
LinkDB
Position
4:complement(2220850..2234260)
AA seq 394 aa
MATFKEHLQERSAHSIGYPINFEFDFGPVIEFLNMRLNNAGDPFMECNYGIHSKKFEIAV
LDWFARLWELPKDQYWGYVTSGGTEGNMHGLLVGRELFPEGIIYTSCDSHYSIFKAAKMY
RVQCIKIDTLFSGEMDYADFRRKLLQNTRSPAIVNVNIGTTMKGAVDDLDEVVMILENCG
FANRFYIHCDSALVGLMMPFIKQAPKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDI
NHVMSTNIEYISSNDTTIAGSRNGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRL
REMGVSVFLNALSITVVFERPNDETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFT
KSRIALHQDKCVAGDVSQENCLCSLHLDRKKEAV
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggcaactttcaaggagcacctccaggagaggtctgcccattctattggctacccaatc
aatttcgaatttgactttggccctgtaatagaattcctaaacatgcgcctaaataatgct
ggtgacccttttatggagtgcaactatggtatccattcaaaaaagtttgaaattgcagtg
ttagattggttcgctcggttgtgggaactccccaaagaccaatactggggctatgtcact
agcggtggaacggaagggaacatgcacggacttcttgttgggagagaactttttccggag
gggattatctatacatcatgtgattcacattattctattttcaaggctgctaaaatgtat
agagtccagtgcatcaaaattgacactttgttttctggtgagatggattatgctgatttc
agacgaaaactactacagaacactaggagccctgccattgtgaatgtcaatattggtact
actatgaaaggcgcagttgatgatcttgatgaggttgtaatgattcttgaaaactgtggt
tttgcaaacagattttatatccattgtgacagtgctctagtaggccttatgatgccattt
atcaaacaagcaccaaaactaactttcaagaaaccaatagggagcatctgtatttctggc
cacaagtttattggatgcccaataccatgtggtgttctaataaccaggttgatggatatc
aatcatgtaatgtccacaaacattgagtacatctcttcaaatgacacaaccatagcagga
agcaggaatggccatgctcccatctttttgtggtatgcactgaagcgtatagggtacaat
ggtctttgcaagacggttgaaaattgcttaaaaaatgcccagtaccttgcacttcgtctc
agagagatgggggtaagtgtgttcttgaatgcactaagtatcacggttgtgtttgagagg
ccaaacgacgaaacatttgtgcgcaaatggcagcttgcctgtcagggaaagatagcacat
gtagtggtgatgccaaatgtgagccttgaaaggattaatatgtttcttgaagagttcacc
aagagcagaatcgcattgcatcaagataaatgtgttgctggagatgtgagccaagagaac
tgcctatgcagtcttcatcttgacaggaagaaagaggcagtatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329593
Entry
4329593           CDS       T01015                                 
Name
(RefSeq) serine decarboxylase 1
  KO
K25193  serine decarboxylase [EC:4.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4329593
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.-
     4329593
SSDB
Motif
Pfam: Pyridoxal_deC
Other DBs
NCBI-GeneID: 4329593
NCBI-ProteinID: XP_015626683
UniProt: Q6ESZ9
LinkDB
Position
2:20109002..20112443
AA seq 482 aa
MVGSVGNGLVDLGGAAVAVNGVGKGMRPEAVAVAMEVESPPRPAEEEGEGSPTRREIVLG
RNVHTASFAVKEPDADDEETGEREAAMASVLALYRRNLVERTKHHLGYPYNLDFDYGALG
QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARIWELEKNEYWGYITNCGTEGNLHG
ILVGREVFPDGILYASRESHYSVFKAARMYRMDCVKVDTLISGEIDCEDFQRKLLLNRDK
PAIINVNIGTTVKGAVDDLDLVIKTLEEGGFKDRFYIHCDGALFGLMIPFVKKAPKVSFK
KPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIFLW
YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQ
LACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIH
KK
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggtggggagcgtcgggaacggcctggtcgacctgggtggcgcagccgtggccgtgaac
ggcgtcgggaaggggatgcgccccgaggcggtggcggtggcgatggaggtggagtcgccg
ccgaggcctgcggaggaggagggggaggggtcgccgacgaggagggagatcgtgctgggg
aggaacgtgcacacggcgtcgttcgcggtgaaggagcccgacgcggacgacgaggagacc
ggggagcgggaggccgccatggccagcgtcctcgcgctctaccgccgcaacctcgtcgag
cgcaccaagcaccaccttggttacccgtataacctggacttcgactatggtgcacttggc
cagctgcaacacttctccatcaacaaccttggtgatcccttcatcgagagcaactatggt
gtacattccaggcagtttgaggtgggagtattggattggtttgctcgcatctgggagttg
gaaaagaatgagtactgggggtacattacaaactgtggcacagaaggaaacctgcatggt
attcttgttgggagagaggtattccctgatggaatcctgtatgcttcccgtgagtctcac
tattcagtattcaaggcagcaaggatgtataggatggattgtgttaaggtggacaccctt
atttctggggaaatagattgtgaagattttcagagaaagttattgctaaacagagacaaa
cctgccattattaatgttaacattggaacaactgttaagggggctgtcgatgatcttgac
ttggttattaaaacacttgaagaaggtggctttaaagatcggttttatatccattgtgac
ggtgctctttttggactgatgataccatttgtcaagaaggcacctaaggtatcatttaag
aagcctatcgggagtgtgagcgtttccgggcacaagtttgtaggatgtcccatgccatgt
ggtgtccagataacaagactggagcacataaatcgtctttctagcaatgttgaatatctg
gcatcaagagatgcgacgatcatgggaagtaggaacggccatgctccgatcttcctctgg
tacaccctgaacaggaaaggctacaggggcttccagaaggaggtccagaagtgcctgagg
aacgctcactacctgaaggaccgcctcaaggaagctggaatcggcgccatgctcaacgag
ctgagcagcaccgtggtgttcgaaaggcccaaggacgaggagttcgtccggaggtggcag
ctcgcctgcgagggcaacatcgctcatgtcgtggtgatgcccagtgtgaccatcgacaag
ctggactacttcctgaacgagctgacggagaagcgggcgacctggtaccaggacggatca
tgccagcctccctgcctcgccaaagacgtaggcgaggagaactgcctctgcagcatccac
aagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270894
Entry
9270894           CDS       T01015                                 
Name
(RefSeq) serine decarboxylase 2
  KO
K25193  serine decarboxylase [EC:4.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    9270894
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.-
     9270894
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5
Other DBs
NCBI-GeneID: 9270894
NCBI-ProteinID: XP_015613225
UniProt: Q8RV06
LinkDB
Position
10:427271..430669
AA seq 467 aa
MVLLNSEEVSCNDHHQVDVVAAAGLQCSGDMLGDKQLVSQVILEGLEIEEPPADEMEAAE
KKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYDFSPLAPFLNFSLNNAGDPFAKVNNSVH
SRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNLYGLLVGRELFPDGILYASNDSHYS
VFKAAKMYRVKCIRIATTVSGEMNYADLKSKLQHNTNSPAIINANIGTTFKGAVDDIDQI
ISTLEKCGFQNRYYIHCDSALSGMMTPFMKQAPKVSFKKPIGSISVSGHKFLGCPMPCGV
VITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLWYTLSKKGYKGLLKEVHICMGNA
RYLEVLLKQVGISASCNTLSNIVVFERPKDERIVCRWQLACEGNLAHIVVMPNVTFEKLT
VFVEELAEKRKDWYQDKGFDIPCLAVDIGKENCYCNLHAKKLRIPKM
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtactgttgaattcagaagaagtctcttgcaatgatcatcatcaggtagatgttgtt
gcagcagccgggctgcagtgcagtggtgacatgctgggagacaagcagcttgtaagccaa
gtgatattggaaggtttggagattgaagagcctcctgcagatgagatggaggctgcagag
aagaaggcagggatatctaggttaatggctggctatgtgcagcacctccaacataggtct
gcctaccatctcggttatccactcaactttgactacgactttagccccctcgcacctttt
ctgaacttttccctcaataatgctggtgatccatttgctaaggtcaacaacagtgttcac
tcaagacaatttgaagttgcagtattgaattggtttgctaatttttgggatgtacaaaga
gaccaattctggggatacatcactagtggtggaacggaagggaacttatatgggctattg
gttgggagagagctttttcccgatgggatcttgtatgcttcaaatgattcacattactct
gtcttcaaggcagctaaaatgtatagagttaagtgcatcaggattgccactacagtttct
ggagagatgaattatgcagacttaaaatctaagctacaacataacaccaacagcccagca
attataaatgccaatattggtactacctttaaaggagctgtagatgatatcgaccagata
ataagtacacttgaaaaatgtggatttcaaaatcgttactacattcattgtgacagcgct
ctctctggaatgatgacgccctttatgaaacaagccccaaaggtgtcattcaaaaaacca
attggctctatcagcgtgtcagggcacaaattcttgggttgtccaatgccatgtggtgta
gtcatcaccaggttggaacatgccgaagtcctgtcaacagatattgagtacatagcttct
agggattccactatcactggaagccgaaatggtcatgctccaatcttcctctggtataca
ttaagcaaaaaagggtacaaaggacttctgaaagaagtacacatatgtatgggaaatgca
cgatacctcgaggtattattgaaacaagttggtataagcgcatcttgcaatacattaagc
aacatagtggtgtttgaaaggccaaaggatgaaagaattgtgtgtaggtggcaacttgct
tgtgagggaaatttagcacatattgttgtgatgccaaatgtcacttttgaaaagctcaca
gtttttgttgaagagcttgctgagaagagaaaagattggtatcaggacaagggattcgat
attccatgccttgcggttgacattggcaaggaaaattgttattgcaacctgcacgcaaaa
aagttaagaattcctaaaatgtga

DBGET integrated database retrieval system