KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276220
Entry
107276220         CDS       T01015                                 
Name
(RefSeq) ribose-phosphate pyrophosphokinase 1-like
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    107276220
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107276220
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     107276220
SSDB
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Other DBs
NCBI-GeneID: 107276220
NCBI-ProteinID: XP_015627898
UniProt: A3AD51 A0A8J8XDQ8
LinkDB
Position
3:19091..20441
AA seq 382 aa
MAFFVKISAPCSLAGHGTTSSSSGSSRSKRGLLLPVGAGAGAGAYGGRQYSDVVPVPALS
QAQASSSGGRLRIFSGTANPRLAQEVACYLGMELGRVKIKRFADGELYVQLQESVRGCDV
FLVQPTCPPANENLMELLIMIDACRRASAKTITAVVPYFGYARADRKMRGGRESIAAKLV
ANLITEAGAHRVLACDLHSGQSIGYFDIPVDHVYGQPVILDYLASKTICPDEVVVVSPDV
GGVARARTFAKKLSDAPLAIVDKRRQGHNQSEVVHLIGDVRGKVAVMVDDMIDTAGTVSQ
GAELLHREGARAVYACSTHAVLSPPAVDRLSSGLFQEVIVTNTVPVLHHRTFPQLTVLSV
ANLLGETIWRVHDDCSVSSIFQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggccttcttcgtcaagatttcggcgccgtgctcgcttgccggccatggcaccaccagc
agtagcagtggcagcagcaggtcaaagaggggattgttgcttccagttggggctggggct
ggggctggggcctacggcggcaggcagtactcggacgtggtcccggtgccagcgctatcg
caggcgcaggcgagctctagcggtggtcggctgcgcatcttctccggcacggcgaacccg
aggctggcgcaggaggtggcgtgctacctggggatggagctggggagggtgaagatcaag
cggttcgcggacggggagctgtacgtgcagctgcaggagagcgtgcgtgggtgcgacgtg
ttcctggtgcagcccacctgcccgccggcaaacgagaacctgatggagctcctcatcatg
atcgacgcatgccgccgcgcctccgccaagaccatcaccgccgtcgtgccctacttcggg
tacgcccgcgccgaccgcaagatgcgcggcggccgggagtcgatcgccgccaagctggtg
gccaacctcatcacggaggccggcgcccaccgcgtgctggcctgcgacctccactcgggg
cagtccatcggctacttcgacatccccgtggaccatgtgtacgggcagccggtgatcctg
gactacctggccagcaagaccatctgccccgacgaggtggtggtggtgtccccggacgtg
ggtggcgtcgcccgggcccgcaccttcgccaagaagctgtcggacgcgccgctggccatc
gtggacaagcggcggcaggggcacaaccagtcggaggtggtgcacctcatcggcgacgtc
agggggaaggtggcggtgatggtggacgacatgatcgacactgcggggacggtgtcccag
ggagcggagctgctgcacagggagggcgccagggccgtctacgcctgcagcacccacgcc
gtgctcagcccgcccgccgtcgacaggctctccagcggcctcttccaggaggtgatcgtc
accaacaccgtccccgtgcttcaccaccggaccttcccccagctcaccgtcctctccgtc
gccaatctcctcggcgagaccatctggcgcgttcacgacgactgctctgtcagtagcatc
ttccagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328168
Entry
4328168           CDS       T01015                                 
Name
(RefSeq) ribose-phosphate pyrophosphokinase 1, chloroplastic
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4328168
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4328168
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     4328168
SSDB
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Other DBs
NCBI-GeneID: 4328168
NCBI-ProteinID: XP_015623376
UniProt: Q6Z2L5
LinkDB
Position
2:complement(1437440..1441176)
AA seq 396 aa
MPLSYSAAAAAAPSPLAARSRGLLRRPPRSSPVVVRCKKIDQLRAVNGIPPYAPVSNRSL
LSPVTLPIIRDANIKNDTRLRIFSGTANPSLSQEIASYLGLELGKINIKRFADGEIYVQL
QESVRGCDVFLVQPTCPPANENLMELLIMIDACRRASAKNITAVIPYFGYARADRKSQGR
ESIAAKLVANMITEAGANRVLVCDLHSSQAMGYFDIPVDHVYGQPVILDYLASKTICSDD
LVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRHGHNVAEVMNLIGDVRGKVAVMMDDMI
DTAGTIAKGAELLHQEGAREVYACCTHAVFSPPAIERLSSGLFQEVIITNTIPLKEDKSF
PQLTILSVANLLGETIWRVHDDCSVGHEPYSSLDID
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgccgctctcctactcagccgccgccgccgccgcgccgtcccctctcgccgcgcgcagc
cgcggcctcctccgccgaccgccgcgctcttcccccgtcgtcgtgaggtgcaagaagatt
gatcaactgagggcagtcaatggaataccaccatacgctccagtgtctaacagatcgttg
ttaagtcctgtgacgctgccgattatccgggatgcgaatattaagaatgatacaaggttg
cgtatcttctcagggactgccaacccttctctttcccaggaaatagcaagttacttgggc
ttagaacttgggaagattaacataaaaaggtttgctgatggcgaaatatatgttcagtta
caagaaagcgtaaggggatgcgatgttttccttgtgcaaccaacgtgccctcctgcaaat
gagaatcttatggaacttctgatcatgattgatgcctgtaggagagcatctgctaagaat
attactgcagtcatcccttattttggttatgccagagctgacaggaagtctcaaggccgt
gaatctatagctgcaaaacttgtagctaatatgattacagaagctggtgcgaaccgtgtc
cttgtatgtgatcttcattccagtcaagccatgggatactttgacatcccagtagatcat
gtttatggtcagcctgtgattcttgattacctcgccagcaagacaatatgttcagatgac
ctggtggtggtgtctccggatgttggaggtgttgccagggcacgtgcttttgccaaaaag
ctatcagatgcacctctagcaattgttgataaaagaaggcatggacacaatgttgccgag
gtaatgaatcttattggagatgttagaggaaaagtggctgttatgatggatgatatgatt
gatacagctggaactattgccaaaggagctgagctgctgcatcaagaaggagcaagagaa
gtctatgcatgctgtacacatgctgtttttagcccgcccgccattgaaaggttatcaagt
ggtttgtttcaagaagtaatcatcacaaacactatacctctcaaggaggacaagagtttc
ccgcagctgactatcctttcagttgctaaccttttaggcgagacaatctggcgtgttcat
gatgattgctcagttggtcatgagccatactctagcttggacattgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341535
Entry
4341535           CDS       T01015                                 
Name
(RefSeq) ribose-phosphate pyrophosphokinase 2, chloroplastic isoform X1
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4341535
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4341535
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     4341535
SSDB
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Other DBs
NCBI-GeneID: 4341535
NCBI-ProteinID: XP_015644180
UniProt: Q69XQ6
LinkDB
Position
6:complement(24789474..24793560)
AA seq 399 aa
MAAKAAALSSSPFVSSRRLSSPAASLRARTPRCVMGSEQVRVVVEEEGKTKKRMGVAEPR
SAPPAVWTPRAPAQEARLAALRTDGRDSRLKIFSGTANRPLAQEIASYLGVDLGKVLIKR
FADGEIYVQLQESVRGCDVFLVQPTCSPVNENLMELFVMIDACRRASARSITVVIPYFGY
ARADRKAQGREAITAKLSANLLTEAGSDRVIVCDIHSTQALGYFDIPVDHIHGQPVILDY
LASKTISKDLVVVSPDVGGVVRARAFAKKLSDAPLAIVDKRRQGHNMSEVMHLIGDVKGK
VAIMVDDMIDTAGTITSAAALLKQEGAEAVYACSTHAVFSPPAIERLSGGIFEEVIVTNS
ILLPEHKCFPQLTVLSMANLVAETIWHVHRDGSVSSIFQ
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggccaaggcggcggcgctctcctcctccccgttcgtctcctcccgccgcctctcc
tcccccgcggcgtctctccgcgcccgcacgccgaggtgcgtgatggggagcgagcaggtg
agggtggtggtggaggaggaagggaagacgaagaagaggatgggggtggcggagccgagg
agcgcgccccccgcggtgtggacgccgcgggcgcccgcgcaggaggcgaggctcgccgcg
ctgcgcaccgatgggcgggattccaggttgaagatcttctccggcacggccaatcgcccc
ctcgcgcaggaaattgcttcttacttgggtgtagacctgggtaaggtcctcatcaagcgt
tttgccgatggggaaatctacgtgcagctgcaggagagtgtgaggggttgcgatgtgttc
ttggtgcagcccacctgctcccctgttaatgaaaaccttatggagctttttgtcatgatc
gacgcatgtcggcgggcgtcggcgaggtctattactgttgtcattccatactttgggtat
gccagagctgacagaaaggctcaaggacgtgaggccattactgccaaactttctgctaat
ttacttacagaagctgggagtgatcgtgtaattgtatgtgatattcattccactcaagca
ttgggatacttcgatattcctgtggatcatatacatggacagcctgtgattctggattac
cttgccagtaagacaatatctaaggatcttgtggtggtttctcctgatgtgggtggtgtt
gtcagagcacgtgcatttgctaagaaattatctgatgcccctttagctatcgttgataag
agaagacagggtcacaacatgtcagaggtcatgcacttaattggtgatgtgaagggtaag
gtcgccatcatggttgatgatatgatagacacagcaggaacaattactagtgcagctgct
ttgttaaaacaggagggagcagaggctgtctatgcttgtagcacacatgctgtcttcagc
cctcctgcgattgaaaggctctctggaggcatctttgaggaagttattgtgacaaactcc
attctgctgccagagcacaaatgcttcccccagttgacagtgctctcaatggcgaacctt
gtggcagaaacaatctggcatgttcatcgcgatggctctgtgagcagcatatttcaatag

DBGET integrated database retrieval system