KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276244
Entry
107276244         CDS       T01015                                 
Name
(RefSeq) sphinganine C4-monooxygenase 2-like
  KO
K04713  sphinganine C4-monooxygenase [EC:1.14.18.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107276244
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     107276244
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-GeneID: 107276244
NCBI-ProteinID: XP_015650499
UniProt: A2ZW68
LinkDB
Position
1:26790147..26791726
AA seq 283 aa
MGFISGEELAVTLAPVAVYWLYSGIYEALGSVRALDRYRLHSRRDEESNNMASKKEVVKG
VLLQQAIQVAISLAVLKLTSEKDGGAGDVKAGHASAPAAAPSSSSAAAALLDVAARFGVA
MFVLDAWQYFAHRLMHSSRYMYRRFHSWHHRVVAPYAFAAQYGHPVDGVLTEALSGAAAY
LASGLPPRAAAFFLAFATVKGIDDHCGLLVPWNPLHAAFANNTAYHDVHHQLSGGRRNFS
QPFFVVWDRLLGTHAGYTVTARERNNGGGLEAKPICNDRHVLL
NT seq 852 nt   +upstreamnt  +downstreamnt
atggggttcatcagcggcgaggagctcgccgtgacgctggcgccggtggccgtgtactgg
ctctactcggggatctacgaggcgttggggagcgtcagggctctggacaggtacaggctg
cactcgaggagggacgaggagagcaataacatggcgtccaagaaggaggtggtgaagggc
gtgctgctgcagcaggccatccaggtcgccatctcacttgccgtgctcaagctgacaagt
gagaaagacggtggcgccggcgacgtcaaggccggtcacgcgagcgccccggcagcggcg
ccatcgtcgtcgtcggcggcggcggcgctactggacgtggcggcgcggttcggggtggcc
atgttcgtgctggacgcgtggcagtacttcgcgcaccggctgatgcactcgagccggtac
atgtaccgtcggttccactcgtggcaccaccgcgtcgtggccccctacgcgttcgcggcg
cagtacggccaccccgtggacggcgtgctcacggaggcgctctccggcgccgccgcgtac
ctcgcctcgggcctgcccccccgcgccgcggccttcttcctcgcgttcgccaccgtcaag
gggatcgacgaccactgcggcctcctggtgccctggaacccgctgcacgccgcgttcgcc
aacaacacggcctaccacgacgtgcaccaccagctcagcggcggccggcgcaacttctcg
cagccgttcttcgtggtctgggaccgtctgctcggcacgcacgccggctacaccgtcacc
gcgcgggagaggaacaacggcggcggcctcgaggccaagccgatctgcaacgatcgccac
gttctcctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330104
Entry
4330104           CDS       T01015                                 
Name
(RefSeq) sphingolipid delta(4)-desaturase DES1-like
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4330104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4330104
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     4330104
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     4330104
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  Sphingolipid
   4330104
SSDB
Motif
Pfam: FA_desaturase Lipid_DES
Other DBs
NCBI-GeneID: 4330104
NCBI-ProteinID: XP_015623789
UniProt: Q6H5U3
LinkDB
Position
2:25660296..25664349
AA seq 328 aa
MGAAAGDGREEEGVMATDFFWSYTDEPHATRRREILAKHPQIKELFGPDPLAFLKIAAVV
SLQLWTATLLRDASWVKILTVAYFFGSFLNHNLFLAIHELSHNLAFTTPSYNRWLGIFAN
LPIGVPMSITFQKYHLEHHRFQGVDGIDMDIPSQAEAHAVKNTLSKSVWVVFQLFFYALR
PLFLKPKPPGLWEFTNLIIQIALDASMVYFFGWKSLAYLILSTFVGGGMHPMAGHFISEH
YVFNPDQETYSYYGPLNLMTWHVGYHNEHHDFPRIPGTRLYKVREIAPEYYNNLKSYKSW
SQVIYMYIMDQTVGPFSRMKRKAPKKDS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggcgccgcggcgggggatggacgggaggaggaaggggtgatggcgacggacttcttc
tggtcgtacacggacgagccgcacgcgacgcggcgcagggagatcctggccaagcatccc
cagatcaaggagctcttcggcccggacccgctcgcctttctcaagattgctgcagttgta
tcacttcagctatggactgccacattactccgagatgctagttgggtgaagatactgaca
gttgcatatttttttggatcctttttgaaccacaatctcttccttgcaatccacgagctc
agtcacaatcttgcgttcacaactccgagctacaatcgctggctaggtatatttgctaac
cttcctatcggtgttcccatgtccattacattccagaagtaccacttggagcaccaccgt
ttccaaggtgttgatggaattgatatggatatccccagccaagcagaggcgcatgctgtt
aagaatactctaagcaaatctgtatgggttgtcttccagctgttcttttatgcccttaga
ccgctgttcctcaagccaaaacctcctggcctgtgggaattcaccaatttgattatccag
attgcgcttgatgccagcatggtgtacttctttggatggaaatcactagcttatctgata
ctctcaacatttgttggtggtggcatgcatcctatggctggacatttcatctcagagcac
tacgtattcaatccagaccaggagacttattcgtattatggacctttgaatctgatgaca
tggcatgttggataccacaatgagcaccatgatttcccaagaattccaggaacaagactg
tacaaggtaagggaaatcgcaccagagtattacaacaatctgaaatcatacaaatcttgg
agccaggtgatatacatgtacatcatggaccaaactgttggtcctttcagccggatgaag
agaaaggcgccgaaaaaagattcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330718
Entry
4330718           CDS       T01015                                 
Name
(RefSeq) sphinganine C4-monooxygenase 1
  KO
K04713  sphinganine C4-monooxygenase [EC:1.14.18.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4330718
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     4330718
SSDB
Motif
Pfam: FA_hydroxylase Cation_ATPase_C
Other DBs
NCBI-GeneID: 4330718
NCBI-ProteinID: XP_015625538
UniProt: Q6YWY7 A3ABB8
LinkDB
Position
2:31299570..31301829
AA seq 265 aa
MGIGASDELLGTFVPIAVYWLYSGLYLALDGVERLDVYRLHPREEEAAKNVVSRGTVVRG
VLVQQAFQVAVSLTLFAVIGDESDIEQKQPSALVILLQFAIAMFVMDTWQYFMHRYMHIN
KFLYKHIHSKHHTLVVPYSFGALYNHPLEGLILDTIGGALSFLVSGMTPRTSIFFFSFAT
IKTVDDHCGLWLPGNILHALFNNNSAYHDIHHQLYGNKYNFSQPFFVIWDKILGTYMPYS
IEHRKGGGFESRPVKLNIAEQTKTD
NT seq 798 nt   +upstreamnt  +downstreamnt
atggggattggggcgtcggacgagctgctgggcacgttcgtgccgatcgccgtgtactgg
ctctactcggggctgtacctcgcgctggacggcgtggagcggctggacgtgtaccggctg
caccccagggaggaggaggccgccaagaacgtcgtctccaggggcaccgtcgtcaggggc
gtcctcgtccagcaggccttccaggtcgccgtctcgctcaccctcttcgcggttattggt
gatgaaagtgatattgaacagaagcaaccttctgcccttgtgatattgctgcaatttgcc
attgcaatgttcgttatggatacatggcagtacttcatgcacagatacatgcacatcaac
aagttcctatataaacatatccactccaagcaccacactcttgtagtcccttattccttt
ggagctctttacaaccatcctcttgagggtcttattttggacaccattggtggtgctctc
tcattcctcgtctctggtatgacaccacggacatccatattctttttctcgttcgcaacc
atcaagacagtggatgatcattgtggtctgtggcttcctggtaacatcctccatgcgctg
ttcaacaacaacagcgcttatcatgacattcatcatcagctctatggaaacaagtacaac
ttttcacaaccattttttgtcatttgggacaagatacttggaacttacatgccttactct
atcgagcacagaaaaggaggagggtttgagtcacggccagttaaactcaacatagcagag
cagaccaagactgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340921
Entry
4340921           CDS       T01015                                 
Name
(RefSeq) sphinganine C4-monooxygenase 1
  KO
K04713  sphinganine C4-monooxygenase [EC:1.14.18.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4340921
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     4340921
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-GeneID: 4340921
NCBI-ProteinID: XP_015642301
UniProt: Q0DCG9
LinkDB
Position
6:complement(13069953..13070935)
AA seq 273 aa
MDPLSDEALAIVVPIVVYWLYSGLYMALGHSISMDKYRLHSKEEEDAKNLVSKRDVVMGV
LLQQLVQAAVAAATFTLAGERRTTTATTASPSSWLAVAARFAVGMVVLDGWQYAWHRWMH
TNRFLYRRVHSWHHRLVAPYAFGAQYNHPAEGLLLDTVGGAVAFLASGMSPRASVVFFSL
CTAKGVDDHCGLWLPAASPLQRVFRNNAAYHDVHHQRRGGRYNFSQPFFVTWDKVLGTHM
PYVVEERPGGGLQVRPVAMSPSSATAAAGASGK
NT seq 822 nt   +upstreamnt  +downstreamnt
atggatcccttgtcggatgaagcgttggccatcgttgttcccatcgtggtgtactggctc
tactctggcttgtacatggcgctcggccactccatctccatggacaagtatcggctgcat
tccaaggaggaggaggatgccaagaacttggtctccaagcgcgacgtcgtcatgggcgtc
ctcctccagcagctcgtccaggccgccgtcgccgccgccacattcacgctcgccggcgag
aggagaacgacgacggcgacgacggcgtcgccgtcgtcgtggctggcggtggcggcgcgg
ttcgcggtgggcatggtggtgctcgacgggtggcagtacgcgtggcaccggtggatgcac
accaaccggtttctgtaccggcgcgtccactcgtggcaccaccgcctcgtggcgccctac
gcgttcggcgcgcagtacaaccaccccgccgagggcctcctcctcgacaccgtcggcggc
gccgtcgccttcctcgcctccggcatgtcgccgcgcgcctccgtcgtcttcttctcgctg
tgcacggcgaagggcgtcgacgaccactgcggcctgtggctgccggcggcgagcccgctc
cagcgcgtgttccggaacaacgccgcctaccacgacgtgcaccatcagcgccgcggcggc
cggtacaacttctcgcagccgttcttcgtgacgtgggacaaggtgttagggacgcatatg
ccctacgtggtagaggagaggcctggaggagggctccaagtgcggccggtggccatgtcg
ccgtcgtcggcgactgcagcggcaggcgccagcgggaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343979
Entry
4343979           CDS       T01015                                 
Name
(RefSeq) sphinganine C4-monooxygenase 1
  KO
K04713  sphinganine C4-monooxygenase [EC:1.14.18.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4343979
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     4343979
SSDB
Motif
Pfam: FA_hydroxylase Cation_ATPase_C
Other DBs
NCBI-GeneID: 4343979
NCBI-ProteinID: XP_015647282
UniProt: Q0D4G3
LinkDB
Position
7:complement(26014815..26017868)
AA seq 258 aa
MVPWEGYVSDETMGTFAPIALYWVYAGGYQLVLHRRPLERYRLHTRAEEEEKNLVALPAV
VRGVLLQQLVQAIVAMILFMVTSDSSAVVVQPPIIIQAFQFLVAMLVMDSWQYFVHRYMH
QNKFLYRHIHSQHHRLIVPYAIGALYNHPLEGLLLDTVGGAISFLVSGMTPRTSVFFFCF
AVLKTVDDHCGLWLPYNIFQSLFQNNTAYHDVHHQLQGSKYNYSQPFFSIWDRILGTHMP
YNLVRRKEGGFEARPLRD
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtgccgtgggaagggtatgtgagcgacgagacgatggggacgttcgcgcccatcgcg
ctgtactgggtgtacgccggcggctaccagctggtgctgcaccggcggccgctggagcgg
tacaggctccacacgcgggcggaggaggaggagaagaacctcgtcgccctccccgccgtc
gtccgcggcgtgctcctgcagcagctcgtgcaggccatcgtcgccatgatcctcttcatg
gttacttcagatagttcagcagttgtagttcagccacctatcatcattcaagctttccag
tttttggttgcaatgcttgtcatggattcatggcagtattttgtgcaccgctacatgcac
cagaacaaattcctctatcggcatatccattcacaacatcatcggctgatagttccctac
gccattggggctctctacaaccatccattggagggactccttctggacaccgtgggtggt
gctatctccttcttggtctctggcatgacaccaaggacttccgtgttcttcttctgtttt
gctgtcctcaagacagttgatgatcactgtggactttggttaccgtataacatcttccag
tccttgttccaaaacaatactgcctatcatgatgtccaccatcagcttcaaggctcaaag
tacaattactctcagccttttttctcaatctgggacagaatactggggacccacatgccc
tacaacttagtaagacggaaggaaggcggttttgaagcaagaccactgcgagactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268279
Entry
9268279           CDS       T01015                                 
Name
(RefSeq) sphinganine C4-monooxygenase 1
  KO
K04713  sphinganine C4-monooxygenase [EC:1.14.18.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    9268279
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     9268279
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-GeneID: 9268279
NCBI-ProteinID: XP_015641488
UniProt: Q67WK8 A3B9V6
LinkDB
Position
6:complement(6589792..6591818)
AA seq 264 aa
MAFAVSDELLGTFVPIAVYWLYSGLYIVLDAMGMDDYRLHPKGEEATKNVVSKWTVVKGV
LVQQSFQIAVSLLLFTIIGDESGTVRKQPPALVIALQFIIAMFVMDTWQYFMHRYMHVNK
FLYKHVHSKHHTLVVPYAFGALYNHPLEGLILDTIGGALSFLIAGMTPKTAIFFFSFATI
KTVDDHCGLWLPGNILHVFFSNNSAYHDIHHQLYGNKYNFSQPFFVMWDKILGTYMPYTL
ENRKGGGFEARPIKLNVAEQSKTD
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgttcgcggtgtccgacgagctgctcggcacgttcgtcccgatcgcggtgtactgg
ctctactcggggctgtacatcgtgctggacgccatggggatggacgactacaggctccac
cccaagggggaggaggccaccaagaacgtcgtctccaagtggaccgtcgtcaagggcgtc
ctcgtccagcagtccttccagatcgccgtctccctcctcctcttcacgatcattggtgat
gaaagtggtactgtgaggaagcagcctccggcccttgtgatagcattgcaattcatcatt
gcgatgtttgttatggacacatggcaatacttcatgcacagatatatgcatgtcaacaag
ttcttgtacaagcatgtccactccaagcaccacactcttgtagtcccgtatgcctttgga
gctctctacaaccatccccttgagggcctcatcctggacaccatcggcggcgccctctcc
ttcctcatcgccggcatgactcctaagacggccatattcttcttctcgtttgcgaccatc
aagaccgtcgatgaccactgcggcctgtggctcccgggcaacatcctccatgtcttcttc
agcaacaacagcgcctaccatgacattcaccaccagctctatggcaacaagtacaacttc
tcgcagcccttctttgtcatgtgggacaagatcctcggaacatacatgccttacactctt
gagaaccgcaagggaggtggattcgaggcgcgcccgattaagctcaatgtggcagagcag
agcaagaccgattaa

DBGET integrated database retrieval system