KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276265
Entry
107276265         CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic-like isoform X1
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107276265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    107276265
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    107276265
   03029 Mitochondrial biogenesis [BR:osa03029]
    107276265
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     107276265
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   107276265
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    107276265
 Prokaryotic type
    107276265
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107276265
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 107276265
NCBI-ProteinID: XP_015635787
LinkDB
Position
4:complement(34744597..34751385)
AA seq 369 aa
MEMGFDEKFALLRSIAEECICEDELRVLLKKKPNPICCVWFEPTSMMGIEQGIMKTIYVN
KMVRAGCTVKILIADWFPQRNPRFTCNLNKIQAIIRYNIMMWKAVGMHLDKVEIIWFSDE
LNHHAVDYWPFAMDVSRKYTMKRMASYCKYVEPYGPGILPAAQIIYPCMLVSAVLCHKLQ
ADIWLFSMDLRDIVMLTRDYCEDTNRGNIPTIFLHSVLPNLLENPEFQNRRNPGRTIFML
DDEDDIEEKISCAFCPSRVVACNPCLEYIKSVVLPWFGKFEVVQKEGNGSNKTYSSMKEL
IADYESGDLDSFDVKLALGKAINDILELVSEFFRSNEEAQAQIVPHRLQDEIGADIQKIQ
LQNEEMSGH
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggagatgggatttgatgagaaatttgcacttctgaggagcattgcggaggagtgcata
tgcgaggatgagctacgcgtattactgaagaagaagcctaatcccatctgctgtgtttgg
tttgagccaacctccatgatgggcatagagcagggtattatgaagacaatctatgtcaac
aaaatggttagagctggctgtacagttaaaatattgatagcagattggtttccgcagcgg
aaccctagattcacctgtaacctaaacaaaatacaggctattatccgctacaatatcatg
atgtggaaggcagttggcatgcaccttgacaaagtagagatcatatggttttctgatgaa
ttgaatcatcacgctgtcgactactggccatttgctatggatgtttccagaaaatacacc
atgaaaagaatggcaagttattgtaagtatgtggaaccatatgggccaggaatacttcct
gctgcccagataatttacccttgcatgctggtttctgctgtattatgccacaagttgcag
gcagacatatggctattcagcatggatctgcgagacattgtcatgctaactagagattat
tgtgaagatacaaataggggaaacataccaactattttcctgcactctgtgctacctaat
ttactagaaaaccccgaattccagaatagaagaaatcctggacggactatcttcatgcta
gatgatgaggatgatatagaagaaaaaataagttgtgctttctgcccttcgagagtagta
gcatgcaacccatgtttggagtatataaaatctgttgtccttccttggtttgggaagttt
gaggtcgttcagaaggaagggaatggtagcaacaagacatattcaagcatgaaggaactt
attgctgattatgaaagtggcgatcttgactcttttgatgtcaagttggcactgggaaaa
gcaataaatgacatattagagcttgtcagcgagtttttccgtagcaacgaggaagctcaa
gctcaaattgttccccacaggttacaggatgaaattggggcagatatccagaagatccaa
ttgcagaacgaggagatgtctggtcattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324476
Entry
4324476           CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4324476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4324476
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4324476
   03029 Mitochondrial biogenesis [BR:osa03029]
    4324476
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     4324476
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4324476
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4324476
 Prokaryotic type
    4324476
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4324476
SSDB
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C
Other DBs
NCBI-GeneID: 4324476
NCBI-ProteinID: XP_015622268
UniProt: A0A0P0V2Y9 Q943W5
LinkDB
Position
1:17301972..17307368
AA seq 497 aa
MASIAMAASLRTFLRPHRCRLLLRQSRSLSASAAPAGAAAASTVIRRSVVEVLRERGLVE
ATTSESLGSASASPRELKAYCGFDPTAESLHLGNLLGLVVLSWFRRCGHNAVALVGGATG
RVGDPSGKSAERPELDLAAVETNSNAIKSLIGQILDRAPEPSQHSQSGKNLNLEQNEQAL
VNSGEKMGSFQILDNYDWWKDITLLDFLKEVGRFARVGTMIAKESVKKRLMSEDGMSYTE
FTYQLLQGYDFLYMFRNMGVNVQIGGSDQWGNITAGTELIRKILQVEGAHGLTFPLLLKS
DGTKFGKTEDGAIWLSPKMLSPYKFYQYFFSVPDIDVIRFMKILTFMSLDEIQELEESMK
KPGYVPNTIQRRLAEEVTRFVHGEEGLEEALKATEALRPGAQTQLDSQTIEGIADDVPSC
FLPYGQVLKSPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGK
VLLLSAGKKNKMVVRIS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggcttccatcgctatggctgcctcgttgcgaaccttcctccgccctcaccgttgccgt
ctcctcctccgccagagccgcagcctctccgccagcgccgccccggccggtgccgccgcc
gcatccacggttatccggcgcagcgtagtggaggtgctccgggagcgggggctcgtggag
gccaccacttctgagtctctggggtcggcttcagcgagccctagggagctcaaggcgtac
tgcggcttcgaccccacggcggagagcctccacctcgggaacctcctcgggctcgtcgtg
ctctcctggttccgccgctgcggtcacaacgccgtcgcgctcgtcggcggcgccaccggc
cgtgtcggtgacccctctggaaagagcgccgagcggcccgagctcgacctcgccgccgtc
gagaccaactccaacgctatcaaatcgctcatcggccagatccttgaccgtgcacccgag
ccctcccaacattcgcaatccggtaaaaacttgaacttggagcaaaatgagcaggctttg
gtcaattcgggagaaaagatgggttcttttcagatccttgataactatgactggtggaag
gacatcacgctgctggatttcctcaaggaggtggggagattcgctcgtgttgggacgatg
atagccaaggagagtgtcaagaagcggcttatgtccgaggacggaatgagctacactgag
ttcacctaccagctgttgcagggctatgacttcctgtacatgttccgcaatatgggtgtt
aatgtgcagattggaggaagtgatcagtggggaaacatcacagcggggactgagttaatt
cggaagattttacaggttgagggggcacacggcctgacattcccactactgctgaagagt
gatgggacgaagtttggcaagacggaggatggagcaatctggctttcgcccaagatgttg
tcaccatacaaattctatcagtacttcttctcagtgccagatattgatgtcataaggttt
atgaagatactgacattcatgagcctggatgagattcaggagctggaagagtcgatgaag
aagcctggctatgtgccgaacacaattcagaggaggcttgcagaagaggtcacacgtttt
gtgcatggtgaggagggattggaggaagcgttgaaagccacggaagccttacggcctggg
gcacagactcagttggattcacaaacaattgaggggatagcagatgacgtaccatcatgc
tttttgccatatggccaagttttgaagtctcccctggttgatctagcagtctccacaggt
ttgcttgctagcaaatcagcggttaggcggcttattaagcaaggggggctatacttaaat
aacataagaattgatagcgaggataagttggttgaggaaggtgatgtagttgatgggaaa
gtgctgttgctatctgctggaaagaagaacaagatggttgtgaggatatcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330562
Entry
4330562           CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic isoform X1
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4330562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4330562
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4330562
   03029 Mitochondrial biogenesis [BR:osa03029]
    4330562
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     4330562
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4330562
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4330562
 Prokaryotic type
    4330562
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4330562
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 4330562
NCBI-ProteinID: XP_015623955
LinkDB
Position
2:complement(29958705..29979210)
AA seq 382 aa
MDNLDDVAFDINEDNVVINSDEKFAVLRSIGDECIYEDELLGLLKNKPSPTCCVWFEPST
NMDIEQGIMKTIYVNRMVKAGCAVKIVTADWFLQRHYKIGNNLSKIRNIGYLNIEMWKAA
GMDLDRVELVWLSDELNLHAVDYWPVAMDVSRRYTMTRIARIFWSNAEHGPQILPAAEII
YPCMQVASILCEKTNIWLFSMDQRDIIMLTRDYCENINWVNKPTILLHDALPNLLEDPEY
VDLRDRGRTIFMHDEEHTLNSKIQRAFCPPKVVVHNPCLEYIKYIILPWFGNLEVVQNEW
NGSTKTFVSMEELSVDYERGYLNSADVKMALEKAINNILEPVRDYFSGNTKAQALIMACQ
LQNEITGDVLKIQMQNKEMRHH
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggataacttagatgatgttgccttcgacatcaacgaggataacgtggtgattaattct
gatgagaagtttgcagtactgaggagcataggagatgaatgcatctatgaggatgaactc
ctcggcctgctgaagaataagcccagtcctacatgctgtgtttggtttgagccatccacc
aatatggacatagagcaggggattatgaagacaatctatgtcaacaggatggtcaaagct
ggttgtgcagtcaaaattgtgacggcagattggtttttgcagcgtcattataagattggc
aacaacctaagtaaaatacggaacattggctatctcaatattgagatgtggaaagcagct
ggcatggaccttgacagggtagagcttgtgtggttgtcagatgaattgaatctccatgca
gttgattactggccagttgccatggatgtctccagaagatataccatgacaagaattgca
aggatcttttggagtaatgcagaacatgggccacaaatacttcctgctgctgagataatt
tatccttgcatgcaggttgcttctatattatgcgagaagacgaacatatggctattcagc
atggatcaacgagatattatcatgctcactagagattattgtgaaaacataaactgggtg
aacaaaccaactattttgctgcatgatgctctacctaatttactagaagatcctgaatat
gtggacttgcgagatcgtggacgaactatcttcatgcatgatgaggagcacactttaaat
tcaaaaatacagagggcattctgtcctccaaaagtagtggtacacaacccatgtctggag
tatatcaaatatatcatcctaccttggtttgggaacttggaggtagtccagaatgaatgg
aatggtagtaccaagacatttgtaagcatggaagaacttagtgttgattatgaaagaggt
tatctcaattctgctgatgttaagatggctcttgagaaagcaataaacaacattctagag
cctgtccgtgactacttcagtggtaacactaaagcccaagctctaattatggcctgccag
ttgcagaatgaaattactggagatgtcctgaagattcaaatgcagaacaaagagatgcgc
catcattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344270
Entry
4344270           CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic isoform X1
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4344270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4344270
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4344270
   03029 Mitochondrial biogenesis [BR:osa03029]
    4344270
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     4344270
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4344270
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4344270
 Prokaryotic type
    4344270
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4344270
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 4344270
NCBI-ProteinID: XP_015647518
LinkDB
Position
7:complement(28584743..28593361)
AA seq 424 aa
MLARAFGLVGKTWKRTPTMSVEASASPRRRSQMPQQQLCHLHGSTPSQRQKFPEEQLPGD
TVEGSFDLRFAALKSIGEDRVNDRELKLLLKKKHAPICYVWCDPCPWMHISQGIMKTLNI
NKMVESGFKVKILMADWFSQMNSEISGNLNKMRTVGRYNIEMWKATGMALDKVDLVWLSD
EIRQHGDEYWPIVMDIARTNSVRRIKSTCRSSYYCLPSRFCGSRNSYAIGKLNVDEIFYI
CLQCASILFQKADIWLLGMEQHDANLLARQYYKHFKKKNKAIAVLDNMLPNLLQYPQMEN
RRHPAWAIFMEDDKEDICFKMEKAFCPPKLAEGNPCLEYIKYIILPWFGMFEVVQKKGNG
GKKTFLSMEELTADYESGALHPADVKLALEKSLNEILQPVRDHFGRNGEAKDLVEAIGEC
YGAD
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgctagcgcgggcgtttggcctcgtgggcaaaacatggaagcgaacgccgactatgtcc
gtcgaggcttccgcctcgccgcgccgccgctcccagatgccacagcagcagctttgtcat
ctccacggcagcacgccgtcacaacggcaaaagttccccgaagaacagctcccgggggat
actgttgaggggagttttgacctgaggtttgcagcactgaagagcattggggaggatcgg
gtcaacgatcgtgagcttaagttactgctaaagaagaaacatgcccccatttgttatgtt
tggtgtgatccatgcccctggatgcacatttctcaggggatcatgaagacactcaatatt
aataaaatggttgaatctggtttcaaagttaaaatcttaatggcagactggttttcccag
atgaacagtgagattagtggcaatctaaataagatgcggactgttggcaggtacaatatt
gagatgtggaaagcaactggcatggctcttgataaagtagatctagtctggttgtcagat
gaaatacgtcaacatggtgatgagtactggccaattgtcatggatattgcaaggacaaac
agtgtgcgtagaataaaaagtacatgcaggtcctcttattactgtttacctagcagattt
tgtgggagtagaaattcttatgcgattggaaaattaaatgttgatgagattttttacatt
tgcttgcagtgtgctagcatattatttcagaaggcagacatatggctgttgggaatggaa
cagcatgatgccaacttattagctagacaatattataagcatttcaaaaagaagaataag
gcaattgctgttttggacaatatgcttcctaatttattacaataccctcaaatggagaac
aggaggcatccagcttgggctatcttcatggaagatgataaggaggatatatgttttaaa
atggaaaaagctttctgccctccaaaactagcagaaggcaatccatgtttggagtacata
aaatatatcatcttgccttggtttggaatgtttgaggtggtccagaagaaagggaatggt
ggcaaaaagacttttctgagcatggaggaacttacagctgattatgaaagtggcgctctg
catcctgctgatgtgaagctggcccttgaaaagtcattgaacgagatattgcagcctgtt
cgtgatcactttggaaggaatggtgaagcaaaggatctagtggaagctatcggggaatgc
tacggtgctgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344663
Entry
4344663           CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4344663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4344663
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4344663
   03029 Mitochondrial biogenesis [BR:osa03029]
    4344663
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     4344663
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4344663
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4344663
 Prokaryotic type
    4344663
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4344663
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 4344663
NCBI-ProteinID: XP_015648441
UniProt: B9FZ31 Q84PX0
LinkDB
Position
8:2924198..2928514
AA seq 394 aa
MDPSQPSGSSADASASSSSSSSSSAVENLAAGMAAMSLQDRFELLRGIGEECIQEDELMN
LLQKKPVPICYDGFEPSGRMHIAQGIVKTINVNKMVRAGCKVKIWIADWFAQLNNKMGGD
IKKIQTVGRYMIEIWRAAGMNLDGVEFLWSSEEINKRANEYWPLVMDIARKNNVKRIMRC
CQIMGRNDSDELTAAQIFYPCMQCADIFFLKADICQLGMDQRKVNMLAREYCDDIKRRNK
PIILSHHMLPGFKEGQEKMSKSDPSSAIFMEDDEAQVNLKIKQAFCPPNIVDGNPCLEYI
KYIVFPWFETFEVVRKEENGGNKTFANMNELIADYESGALHPADVKPALAKAINQILQPI
RDHFKNNSEAKVLLNTVKNYKVKTEDTSSSPQAS
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggacccctcgcagccgtccgggagctccgccgacgcctcggcgtcctcctcctcctcc
tcctcctcctccgccgtggagaatctcgccgcggggatggcggccatgagcctccaggat
cggttcgagttgctgcgggggatcggcgaggagtgcatccaggaggacgagctcatgaac
ctgctgcagaagaagcccgtccccatctgctacgacggtttcgagccctccggccgcatg
cacattgctcagggcattgtgaagacaatcaatgttaacaagatggtcagagctggatgc
aaagtgaaaatttggatagcagactggtttgctcagctaaacaacaagatggggggtgat
ataaaaaaaatacagactgtgggacgctacatgattgagatttggagagcggctggtatg
aatcttgatggtgtggaattcttgtggtcctcagaggaaatcaataagcgtgcaaatgaa
tattggccacttgtaatggacattgctcgtaaaaataatgtcaaaagaataatgagatgt
tgtcagattatgggtcggaatgattcggatgagttgactgctgcccagatcttctatcct
tgcatgcagtgtgctgatatatttttcttaaaggcagacatttgccagttgggcatggac
caaaggaaggtcaatatgctagccagggagtactgtgatgacatcaaaaggagaaacaaa
ccaattattctgtcacatcatatgctccctggttttaaggagggccaagaaaagatgtca
aagagtgatccatcctcagccatttttatggaagatgacgaggctcaggtaaatttgaag
ataaaacaagcattttgccctcccaacattgttgatggcaatccatgcttggagtacatc
aagtacattgttttcccttggtttgaaacgtttgaggtggttcggaaggaagaaaatggc
ggtaacaagacatttgccaacatgaatgaactcatcgctgattatgagagtggtgctttg
catcctgctgatgttaaaccagctcttgcaaaagcgataaaccaaatattgcagcctatc
cgtgaccacttcaaaaacaacagtgaagcaaaagttctgctcaacactgttaagaattac
aaagtaaaaacggaggatactagttcaagccctcaagcatcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344859
Entry
4344859           CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic isoform X1
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4344859
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4344859
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4344859
   03029 Mitochondrial biogenesis [BR:osa03029]
    4344859
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     4344859
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4344859
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4344859
 Prokaryotic type
    4344859
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4344859
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 4344859
NCBI-ProteinID: XP_015649123
LinkDB
Position
8:complement(5378757..5384249)
AA seq 367 aa
MAGDADSGGLPGGEAAEEMGMGGEEERVATLLGIAEECDTEEELRLLLRGNPHPVCYDSF
LPCDRMTIAQGVLKAIHVRKMVEAGCRVKIWIDDWSAFLNNKLGGDMEKIQTVGRYMIEV
WKSIGMNHDGVEFLCSSAEINSRADEYWPRVMGISTHRKIGVVRELRECKKPTAQFFNPC
MQCAGIFFLEADICQMGMDQHEVNKLATTYSDNRQEKKPIILSHYLLPGLKGQNKMSASD
PASAIFMDDEKAEIDLKIKQAFCPPKIVKGNPCIEYIKYIIFPWFGKFEVVRKAKNGGNK
TFMSVEELVMDYESGSLHPADVKPALKEAINQILKPVREHFENNKEAKFLRDTVKLSLQG
YSEVNSE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggccggcgatgccgattccggtggcctcccggggggcgaggcggcggaggagatgggg
atgggcggcgaggaggagagggttgcgacgctgctagggatcgcggaggagtgcgacacg
gaggaggagctccggctgctgctgcgggggaatccccaccccgtctgctacgacagcttc
ctgccctgcgaccgcatgaccattgcccagggtgttttgaaagcaatacatgtgagaaaa
atggtagaagctggatgcagagtaaaaatctggatagatgattggtctgccttcctgaac
aacaagctgggaggtgacatggaaaaaatccagactgttggccgctacatgatagaggtc
tggaaatccattggtatgaaccatgatggggtagaatttctttgttcatcggctgagatc
aatagtcgggcagatgaatattggccacgtgtcatgggtattagcacacaccgcaagatt
ggagttgtgagggagctcagggaatgcaaaaagcctactgcccagttcttcaacccttgc
atgcagtgtgctggcatattcttcctagaggcagacatttgtcagatgggcatggatcag
catgaggtcaacaagctagcaacaacgtattctgataacagacaggaaaagaagccaatt
attctgtcacactacttgctccctggcttgaaagggcagaacaagatgtctgctagtgat
ccagcatcagccatcttcatggatgatgagaaggctgagatagatttaaagataaaacag
gctttctgccctccaaagattgtcaagggaaatccatgtattgagtacataaaatacatc
atttttccttggtttggcaaatttgaggtggtccggaaggctaaaaatggtggaaacaag
acatttatgagcgtggaagaactagtcatggactatgagagtggttccttgcatcctgct
gatgtaaagcctgctctgaaagaagcaataaaccaaatattgaaacctgtccgtgagcac
tttgaaaacaacaaggaagccaaattcttgcgtgatacagttaagttatccttgcagggc
tacagcgaggtcaatagtgaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269094
Entry
9269094           CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic isoform X1
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9269094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9269094
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9269094
   03029 Mitochondrial biogenesis [BR:osa03029]
    9269094
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     9269094
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   9269094
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    9269094
 Prokaryotic type
    9269094
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    9269094
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 9269094
NCBI-ProteinID: XP_015612872
LinkDB
Position
1:37543771..37551359
AA seq 441 aa
MIARAFGLVGKAWKRTPASTPPRRRSDLPALLRRLHSRSAQPEIFREERPHLQNNSGGAP
PRLDLISEQNWSKQCYNVNTMTSADSAVDSIRDTVEGSFDQRFATLKSIGEDRVKDSELE
LLLKKKSAPVCYVWCDPTPFMRISQGIITTLSVNKMVKSGYKVKILMADWIAQMNRNIGG
NLSEMRTIGLYNIEMWKAAGMALDRVEIVWLSDEISRLADEYWPLAIDVARKTTVSIIKR
CCGRDLIEEFTAADIFYLSFQCATILFQKVDIWLLGMDQHEANLLAREYCKRVKRRNKPV
AVSHKKLPNLLQYPEEEHRRNPFLAIFMDDSTVDISRKIKHAFCPPKLAEGNPCLEYIKY
IILPWYGKFEVVREKEDGGNKTFLSMEELTADYVSGVLHPGDMKLALANSLIKILQPVYD
HFKSNAEAKKALQGIEKYYKI
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgatagcgcgggcgtttggccttgtgggcaaagcatggaagcgaacaccggcctcgacg
ccgccgcgccgccgctccgacttaccggcgctgcttcgtcgcctccacagcaggtcggca
caaccggaaatattccgcgaagaacggccccacctacaaaataatagcggaggagctccg
ccaaggctggacttaatctcagaacaaaactggagcaagcagtgctataatgtcaacact
atgacttcagccgattctgccgtcgactctattagggatactgttgaggggagttttgat
cagaggttcgcaacactaaagagcattggggaggaccgtgtcaaagacagcgagcttgag
ttactgctaaagaagaaatctgcccccgtttgctatgtttggtgtgatcccacccccttt
atgcgcatatcccaggggatcataacgactctttctgttaataagatggttaaatctggt
tacaaagttaaaatcctaatggcagactggattgcccagatgaaccgtaatattggtggc
aatctaagtgaaatgcggactattggcttgtacaatattgagatgtggaaagcagctggt
atggcccttgatagggtagagatagtgtggttgtcagatgaaataagtcggcttgctgat
gaatattggccacttgccatagatgttgcaagaaaaaccactgtgagtataataaaaagg
tgttgtgggagagatctaattgaagaattcactgctgctgatatattttacctttctttt
cagtgtgctaccatattatttcagaaggttgacatatggctcttgggcatggatcaacat
gaggccaatttgttagctagagaatactgcaagcgtgtaaaaaggcggaacaagccagtt
gcagtgtcacacaaaaagcttcctaatttattacaatatcctgaagaagaacataggagg
aacccattcctagccatcttcatggatgattctacggttgatatcagtagaaaaataaaa
catgctttctgccctccaaaattagcagaaggcaatccatgtttggagtacataaaatat
atcatcttaccatggtatggaaagtttgaggtggttcgggagaaagaggatggtggtaac
aagacgttcctgagcatggaggagcttactgctgattatgtaagtggggttctgcatcct
ggtgacatgaagctggctctcgcaaattcattaatcaaaatattgcagccggtctatgat
cacttcaaaagcaatgctgaagccaaaaaagcactgcaaggcattgagaaatactacaag
atctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271247
Entry
9271247           CDS       T01015                                 
Name
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9271247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9271247
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9271247
   03029 Mitochondrial biogenesis [BR:osa03029]
    9271247
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     9271247
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   9271247
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    9271247
 Prokaryotic type
    9271247
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    9271247
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 9271247
NCBI-ProteinID: XP_015650259
UniProt: B9F0V7
LinkDB
Position
8:13919922..13925452
AA seq 380 aa
MDPSAPSGSSADASASSSSSAVEDLAPGMAAMSLQDRFELLRGIGEECIQEDELMNLLQK
KPVPICYDGFEPSGRMHIAQGIVKTINVNKMVRAGCKVKIWIADWFAQLNNKMGGDLKKI
QTVGRYMIEIWRAAGMNLDGVEFLWSSEEINNRANEYWPLVMDIACKNNVKRIMRCCQIM
GRNDSDELTAAQIFYPCMQCADIFFLKADICQLGMDQRKVNVLAREYCTDIKRKNKPIIL
SHHMLPGFKEGQEKMSKSDPSSAIFMEDDEAQVNLKIKQAFCPPNVVDGNPCLEYIKYIV
FPWFEMFEVVRKEANGGNKTFTNMDELIDDYKTGALHPADVKPALAKAINQILQPIRDHF
NNNSEAKILLNTVKKYRVTN
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggacccttcggcgccgtccggtagctccgccgacgcctcggcgtcctcctcttcttcc
gccgtagaggacctcgccccgggcatggcggccatgagcctccaagaccggttcgagttg
ctgcggggcatcggcgaggagtgtatccaggaggacgagctcatgaatctgctgcagaaa
aagcccgtccccatctgctacgacggatttgagccctccggccgcatgcacattgcccag
ggcattgtgaagacaatcaatgttaacaagatggtcagggctggatgcaaagtaaaaatt
tggatagcagactggtttgctcagctcaacaataagatggggggtgatctaaaaaaaatc
cagactgttggacggtacatgattgagatttggagagcagctggtatgaatcttgatggt
gtggaattcttgtggtcctcagaagaaatcaataatcgtgcaaatgaatattggccactt
gtaatggacattgcctgtaaaaataatgtcaaaagaataatgagatgttgtcagattatg
ggtcgaaatgattcggatgagttgacagctgcccaaatattctatccttgtatgcagtgt
gctgatatatttttcttgaaggcagacatttgccagttgggcatggaccaaaggaaggtc
aatgtgctagccagggagtactgtaccgacatcaaaaggaaaaacaaaccgattattttg
tcacatcacatgctccctggttttaaggagggccaggaaaagatgtcaaagagtgatcca
tcctcagccatttttatggaagatgacgaggctcaggtaaatttgaagataaaacaagca
ttttgccctcccaacgtggttgatgggaacccatgcttggagtacatcaagtatattgtt
ttcccttggtttgaaatgtttgaggtggttcggaaggaagcaaatggcggtaacaagaca
tttacaaacatggatgaactcatcgatgattataagactggtgctttgcatcctgctgat
gttaagccagctctagcaaaagcaataaaccaaatattgcagcctattcgtgaccacttc
aataacaacagtgaagcaaagattctgcttaacactgttaagaagtacagagtaaccaac
taa

DBGET integrated database retrieval system