KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276273
Entry
107276273         CDS       T01015                                 
Name
(RefSeq) cystathionine gamma-synthase 1, chloroplastic-like
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    107276273
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107276273
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107276273
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     107276273
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Orthopox_A5L
Other DBs
NCBI-GeneID: 107276273
NCBI-ProteinID: XP_015613967
LinkDB
Position
10:13438046..13444187
AA seq 406 aa
MSSIIKFSSAYASDKTLAVHAGEKLGSGAAAAETDSIATPIVGGTTHWFRDSADLIAFRE
GRRRSFEYGRYGNPTVKVLEEKISALERAEATLVTSSGMNAIVATLLALVPPGGHVVATA
DCYSEARAFIRDKLSNMGITSTFVDLDDDMEALESVLDEGEVTMFYADSMTNPHLKVVDV
TRVAELCHRRGALVCIDSTLASPINQKPLALGADVVLHSATKYIAGHHDVIAGCVSGSEA
LVSRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKHPKIERVYY
PGLESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGGCESLVQQP
AIMSYWGKCDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtcttcgattataaaattttcctccgcatacgcctcggacaagacgctggcggtgcac
gccggggagaagctcgggagcggcgccgccgccgcggagacggactcgatcgcgacgccg
atcgtgggcggcacgacgcactggttcagggactcggccgacctcatcgccttccgggaa
ggccggcggcggagcttcgagtacgggcggtacggcaacccgacggtgaaggtgctggag
gagaagatcagcgcgctggagagggcggaggcgacgctggtgacctcctccggtatgaac
gccatcgtcgccacgctgctcgccctcgtccctcccggcggccacgtcgtcgccaccgcc
gactgctacagcgaggcccgcgcattcatccgcgacaagctctccaacatgggcatcacg
tcgacgttcgtggatcttgacgacgacatggaggctctggaatccgttcttgatgagggc
gaggtgacgatgttctacgccgactcgatgacgaaccctcacctgaaggtcgtcgacgtg
acacgcgtcgcggagctgtgccaccggagaggcgcgctggtgtgcatcgacagcacgctg
gcgtcgcccatcaaccagaagccgctcgccctcggcgccgacgtggtcctccactccgcc
accaagtacatcgccggccaccacgacgtcatcgccggctgcgtcagcggctcggaggcc
ctcgtctcgcggatccgcacgtggcaccacgacctcggcggcgccatcagtccgaatgcg
gcgtacatgatcattcggggattgaagacgttggcgctgcgggtgcaggcgcagaacagg
acggcgctgcggatggcgcagctgctggagaagcaccccaagatcgagcgcgtctactac
cctgggctggagagcagcccgtggcacggcgtagcgacgaggcagatggctggtgcaggc
ggcgtggtcggcttggaggtggcgtcggacatgcgcggcgcgatgaggttcgtggacgcg
ctggagttgccgctcatcgcgacgtcgctcggcggctgcgagagccttgtccagcagccc
gcaatcatgtcctactggggtaagtgcgacgaggagaaggcaaagaatgggatcaaggac
aactttgtgaggttcagttttgggatcgagaagtttgaggatctcagggatgacatactc
caagccttagggaagatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332956
Entry
4332956           CDS       T01015                                 
Name
(RefSeq) cystathionine gamma-synthase 1, chloroplastic
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4332956
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4332956
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4332956
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     4332956
SSDB
Motif
Pfam: Cys_Met_Meta_PP Beta_elim_lyase Aminotran_5 Met_gamma_lyase
Other DBs
NCBI-GeneID: 4332956
NCBI-ProteinID: XP_015631238
LinkDB
Position
3:complement(14850451..14854548)
AA seq 514 aa
MATVSSLPSPAFLAADPAAALPSATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSD
PARPASLPGGGAGGRRGASSRAAATPAAAAAASAAAEATAEVGAIPNAKLGQPSAAALAE
QALLGSDASLAVHAGERLGRRIATDAITTPVVNTSAYWFNNSQELIDFKEGRHASFEYGR
YGNPTTEALEKKMSALEKAESTVFVASGMYASVAMLSALVPAGGHVVTTTDCYRKTRIYM
ETELPKRGITMTVIRPADMDALQNALDNNNVSLFFTETPTNPFLRCIDIDLVSKMCHSKG
ALLCIDSTFASPINQKALTLGADLVIHSATKYIAGHNDVIGGCISGRDELVSKVRIYHHV
VGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPGLPSHPEHHI
AKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAIMSYWDSKEQ
REIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggccaccgtctcctccctcccgtccccggcgttcctggccgccgacccggccgccgcg
ctcccctccgccaccatcctccgcttcccgccaaacttcgtccgccagctcagcaccaag
gcccgccgcaactgcagcaacatcggcgtcgcgcagatcgtcgccgccgcctggtccgac
cccgcgcgccccgcctccctccccggcggcggcgccggcggccgtcgcggcgcctcctcc
cgcgccgccgccacgcccgccgccgccgccgccgcctccgcggcggcggaggccacggcc
gaggttggcgccatccccaacgccaagctcggccagccgtccgccgccgcattggccgag
caggccctgctcggttcagacgccagcctcgccgtccacgcgggcgagaggctgggcaga
aggatcgccacagacgcgatcaccacgccagtagtgaacacctcggcctactggttcaac
aactcgcaggagctcattgacttcaaggaggggaggcatgctagcttcgagtatgggagg
tatggtaacccgaccactgaggcattggagaagaagatgagtgcactggagaaagccgag
tccactgtctttgtggcatccgggatgtatgcaagtgtggctatgctcagcgcgcttgtt
ccagcaggtgggcacgttgtgaccaccactgattgttaccgcaagacgagaatttacatg
gagactgaactacctaagaggggaattacgatgaccgttattagacctgctgacatggat
gctctccaaaatgcactggataataataatgtatccctattcttcaccgagactcctact
aatccatttctgagatgcatcgacattgatcttgtctcaaaaatgtgccatagcaaggga
gcattgctttgtattgatagtacctttgcatccccaatcaatcagaaggcactaactcta
ggtgctgacttagttatccattcagcaacaaagtacattgctgggcacaatgatgttatt
ggaggctgcatcagtggcagagatgagctagtttccaaagtccgcatctatcaccatgta
gttggtggtgttctaaatccgaatgctgcctacttgattcttcgaggcatgaagacactg
catctccgtgtacaatgtcagaataatactgcaatgcggatggcccaatttttagaggaa
catccaaagattgcacgtgtctactatcctggtctgccaagtcacccagaacatcacatt
gccaagagtcagatgaccggctttggtggtgtcattagttttgaggttgctggagacttt
gatgctactaggagatttattgattctgttaagataccctatcatgccccatcatttggg
ggctgtgagagcattattgatcagcctgccatcatgtcttactgggattcaaaggagcag
agagaaatctatggaatcaaggacaacttgatcaggttcagcattggagtggaggatttt
gaggatttgaagaatgacgttgttcaggcgcttgacaagatctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348560
Entry
4348560           CDS       T01015                                 
Name
(RefSeq) probable cystathionine gamma-synthase 2
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4348560
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348560
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4348560
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     4348560
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Other DBs
NCBI-GeneID: 4348560
NCBI-ProteinID: XP_015613902
UniProt: Q94I44 A3C4H8
LinkDB
Position
10:complement(13449029..13451087)
AA seq 472 aa
MAKSSSLVTKVLVQRRRRVHRSRRSPTKPERAAAADTFGSLAGCPSSPEYPVVPDLDDCV
VDTAVDDAPVVAAEAAGRRASDETLAVHAGEKLGSGAAETDSIATPIVSGTTHWFRDSAD
LIAFREGWRRSFEYGRYGNPTVKVLEEKISALERAEATLVTSSGMNAIVATLLALVPPGG
HVVVTADCYSEARAFIHDKLSKMGITSTFVDLDDDMEALESVLDEDEVTMFYADSMTNPH
LKVVDVARVAELCHRRGALVCIDSTLASPINQKPLALGADVVLHSATKYIAGHHDVIAGC
VSGSEALISRIRAWHHDLGGAISPNAAYMIIRGLKTLALRVEAQNRTALRMARLLEKHPK
IERVYYPGLESSPWHGVATRQMAGAGGVVSFEVASDMRGVMRFVDALELPLIATSLGGCE
SLVQQPAVMSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcgaagtcatcgtctctcgtgacgaaggttttggtgcagcggcggcggcgcgttcac
cgttctcgccgttctcccaccaagccggagcgcgctgccgccgccgacacgttcggttcc
ctcgcgggttgtccctcgtcgccggagtatccggtggtgccggacttggacgactgcgtc
gtcgacaccgccgtggatgacgctcccgtggtggcggcggaggcggcaggccgacgcgcg
tcggacgagacgctggcggtgcacgccggggagaagctcgggagcggcgccgctgagacg
gactcgatcgcgacgccgatcgtgagcggcacgacgcactggttcagggactcggcggac
ctcatcgccttccgggaaggctggcggcggagcttcgagtacgggcggtacggaaacccg
acggtgaaggtgctggaggagaagatcagcgcgctggagagggcggaggcgacgctggtg
acctcctccggcatgaacgccatcgtcgccacgctgctcgccctcgtcccccccggcggc
cacgtcgtcgtcaccgccgactgctacagcgaggcccgcgccttcatccacgacaagcta
tccaagatgggcatcacgtcgacgttcgtggatcttgacgacgacatggaggcgctggaa
tccgttcttgatgaggacgaggtgacgatgttctacgccgactcgatgacgaacccacac
ctgaaggtcgtcgacgtggcacgcgtggcggagctgtgccaccggaggggcgcgctggtg
tgcatcgacagcacgctggcgtcgcccatcaaccagaagccgctcgccctcggagccgac
gtggtcctccactccgccaccaagtacatcgccggccaccatgacgtcatcgccggctgt
gtcagcggctcagaggccctcatctcgaggatacgcgcgtggcaccacgacctcggcggc
gccatcagtccgaacgcggcgtacatgatcattcggggattgaagacgttggcgctgcgg
gtggaggcgcagaacaggacggcgctgcggatggcgcggctgctggagaagcaccccaag
atcgagcgcgtctactaccctgggctggagagcagcccgtggcacggcgtcgcgacgagg
cagatggccggcgccggcggcgtggtcagcttcgaggtggcgtcggacatgcgcggcgtg
atgaggttcgtggacgcgctggagttgccgctcatcgcgacgtcgctcggcggctgcgag
agccttgtccagcagccggccgtcatgtcctactggggtaagagtgaggaggagaaggcg
aagaatgggatcaaggacaactttgtgaggttcagttttgggatcgagaagtttgaggat
ctcagggatgatatactccaagccctagagaagatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348561
Entry
4348561           CDS       T01015                                 
Name
(RefSeq) probable cystathionine gamma-synthase 2
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4348561
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348561
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4348561
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     4348561
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Orthopox_A5L
Other DBs
NCBI-GeneID: 4348561
NCBI-ProteinID: XP_015613908
UniProt: Q94I39 A3C4H9
LinkDB
Position
10:13467386..13469640
AA seq 486 aa
MAKSSSLVTKVSAQRRRRVHRPRRSPTKPERSAAAVALSHEKILLAGVDAAADMFGSLAG
CPSSPEYPVVPDMDDRYVDGAVDDAPAAAAGRRASDETLAVHAGEKLGSGAAETDSIATP
IVSGTTHWFRDSADLIAFREGRRRSFEYGRYGNPTVKVLEEKISALERAEATLVTSSGMN
AIVATLLALVPPGGHVVATADCYSEARAFIRDKLSNMGITSTFVDLDDDMEALECVLDES
EVTMFYADSMTNPHLKVVDVTRVAELCHRRGALVCIDSTLASPINQKPLALGADVVLHSA
TKYIAGHHDVIAGCVSGSEALISRIRAWHHDLGGAISPNAAYMIIRGLKTIALRVEAQNR
TALRMARLLEKHPKIERVYYPGLESSLWHGVATRQMAGAGGVVSFDVASDLRGVMRFVDA
LELPLIATSLGGCESLVQQPAVMSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDIL
QALEKI
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggcgaagtcatcgtccctcgtgacgaaggtttcggcgcagcggcggcggcgagtgcac
cgtcctcgccgttctccgaccaagccggagcgctctgccgccgccgtggcgctgagccac
gagaagattcttctcgccggcgttgatgcagccgccgacatgttcggttccctcgcgggt
tgtccctcgtcgccggagtatccggtggtgccggacatggacgaccgctacgtcgacggc
gccgtggatgacgctccggcggcggcggcgggccgacgcgcgtcggacgagacgctggcg
gtgcacgccggggagaagctcgggagcggcgccgctgagacggactcgatcgcgacgccg
atcgtgagcggcacgacgcactggttcagggactcggcggacctcatcgcgttccgggaa
ggccggcggcggagcttcgagtacgggcggtacggcaacccgacggtgaaggtgctggag
gagaagatcagcgcgctggagagggcggaggcgacgctggtgacctcctccggtatgaac
gccatcgtcgccacgctgctcgccctcgtccctcccggcggccacgtcgtcgccaccgcc
gactgctacagcgaggcccgcgcattcatccgcgacaagctctccaacatgggcatcacg
tcgacgttcgtcgatcttgacgacgacatggaggcgctggaatgtgttcttgatgagagc
gaggtgacgatgttctacgccgactcgatgacgaaccctcacctgaaggtcgtcgacgtg
acacgcgtggcggagctgtgccaccggagaggcgcgctggtgtgcatcgacagcacgctg
gcatcgcccatcaaccagaagccgctcgccctcggcgccgacgtggtcctccactccgcc
accaagtacatcgccggccaccacgacgtcatcgccggctgcgtcagcggctcggaggcc
ctcatctcgcggatccgcgcgtggcaccacgacctcggcggcgccatcagtccgaacgcg
gcgtacatgatcattcggggattgaagacgattgcgctgcgggtggaggcgcagaacagg
acggcgctgcggatggcgcggctgctggagaagcaccccaagatcgagcgcgtctactac
cctgggctggagagcagcctgtggcacggcgtcgcgacgaggcagatggccggcgccggc
ggcgtggtcagcttcgatgtggcgtcggacttgcgcggcgtgatgaggttcgtggatgcg
ctggagttgcctctcatcgcaacgtcgctcggtggatgtgaaagccttgtgcagcaaccg
gccgtcatgtcctactggggtaagagtgaggaggagaaggcgaagaatgggatcaaggat
aattttgtgaggttcagttttgggattgagaagtttgaggatctcagggacgacatactc
caggccctagagaagatttag

DBGET integrated database retrieval system