KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276302
Entry
107276302         CDS       T01015                                 
Name
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1-like
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107276302
   01040 Biosynthesis of unsaturated fatty acids
    107276302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    107276302
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     107276302
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     107276302
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   107276302
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 107276302
NCBI-ProteinID: XP_015642771
LinkDB
Position
6:complement(11178994..11181404)
AA seq 325 aa
MAMPIWLILLASLGAVHVAADVLRLVATLTFGLRARPRGDLRRRYGSWAVVTGPTSGIGR
AMALELAGRGLNVVLVGRDPAKLRDVAGAIARSHSHHGVRTKTVVFDFSLVSTVQGEKAM
AALRETVEGLDVGVVVNNAGVAKPGAMFLHEVEVEPLMRMIRVNMLALTKVTAAVLPGMV
MRGRGAVVNIGSASAEALPSFPLYSVYAGTKAYVGEFSRGLSVEYKRKGIDVQCQVPCLV
ETNMISRAMKDIFLSQFVVTPEEYARAAVRSIGHGRMCVPNMAHRVQLLGMRSTPDFVLN
WYRLRLHLQQRAIFRSRRCHRIALL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggccatgccgatatggctcatcctgctggcctccctcggcgccgtccatgtcgccgcc
gacgtcctccgactcgtcgccaccctcacgttcggcctgcgcgcccgtcccaggggggac
ctccgccgccggtacggctcgtgggccgtcgtcaccgggccgacgtcaggcatcggccgt
gccatggcgctggagctcgcggggcgcggcctcaacgtcgtcctcgtcggccgtgacccc
gccaagctccgcgacgtcgccggcgccatcgcccggtcccactcccaccacggcgtgcgc
accaagaccgtggtcttcgacttctccctcgtctccaccgtgcaaggtgagaaggcgatg
gcggcgctaagggagacggtggaggggctggacgttggggtggtggtgaacaatgccggc
gtggcaaagcccggcgcgatgttcctgcatgaggtggaggtggagccattaatgaggatg
atacgggtgaacatgctagccctaacgaaggtgacggcggcggtgctgccggggatggtg
atgaggggcaggggtgctgtcgtcaacatcggctcggcgtcagcggaggctctcccctcc
ttcccgctctactccgtctacgccggcaccaaagcatatgttggtgagttctcaagaggc
ctctccgtggagtacaagagaaagggaatcgatgtgcaatgccaggtgccatgcctggtg
gagacgaacatgatatcgagagccatgaaggatatctttctgtcgcagttcgtggtgacc
ccggaggagtacgcccgtgcggcggtgcggtcgatcggccacgggcggatgtgcgtgccc
aacatggcgcaccgagtgcagctcctggggatgagatccaccccggatttcgtgttgaac
tggtaccgcctgcggctccacttgcagcagcgagccatctttcgaagccgcaggtgtcat
cggatcgcgctcctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277374
Entry
107277374         CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107277374
   01040 Biosynthesis of unsaturated fatty acids
    107277374
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    107277374
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     107277374
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   107277374
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 107277374
NCBI-ProteinID: XP_015621198
LinkDB
Position
1:2721302..2725296
AA seq 241 aa
MTLKPNPSPRRLPPPSRSSAMAADGSVLRRLYFSVYNWVVFIGWAQVSLSMILALLDDGH
EAVYAAIERHLLFAQTAAIMEILHSILGLVRSPVSSTLPQITGRLFITWGILWSFPETHS
HILVTPLIISWSITEVIRYSFFGIKESFGFTPSWLLWLRYSTFIVCYPVGMVSEVGLIYI
AFPFMKASEKYCIGMPNKWNFSFDYFYFSTFLMALYVPVFPYLLRHMVAQRKKALSKAKT
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgacgttaaagccaaacccatctcctcgacgtcttcctcctccatctcgcagctctgca
atggcagcggatggttcagtgctccggaggctctacttctctgtctacaactgggttgtc
ttcatcggatgggctcaggtgtcattgtccatgatcttggcgttgttggatgacgggcat
gaggccgtctatgctgctatcgagcggcatctgctgtttgcacagactgctgccatcatg
gagattcttcattccattctaggattggtgaggtctccagtgtcttctactcttccacaa
attactggaaggttgttcattacctggggcatcttgtggagctttcctgagacgcattct
catattcttgttacccccttgatcataagctggtccatcaccgaggtcatcagatattcc
ttctttggcataaaggaatcatttggatttacaccttcctggctcttatggcttaggtac
agcacctttatagtatgctatcctgttggtatggttagtgaggttggcctaatctatatt
gccttccctttcatgaaggcatctgagaaatactgcattgggatgcccaacaaatggaat
ttctccttcgactacttctatttctctacttttttgatggctttgtacgttccagtattt
ccatacttgttgcgccatatggttgcccagcggaagaaagccttgtcaaaggcaaaaacc
acataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324516
Entry
4324516           CDS       T01015                                 
Name
(RefSeq) very-long-chain enoyl-CoA reductase
  KO
K10258  very-long-chain enoyl-CoA reductase [EC:1.3.1.93]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324516
   01040 Biosynthesis of unsaturated fatty acids
    4324516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324516
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.93  very-long-chain enoyl-CoA reductase
     4324516
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324516
SSDB
Motif
Pfam: Steroid_dh
Other DBs
NCBI-GeneID: 4324516
NCBI-ProteinID: XP_015621959
UniProt: A0A0P0UY87 Q5ZED1
LinkDB
Position
1:complement(2707638..2711452)
AA seq 310 aa
MKVSVVSRSGREVVRGGVELKDSAKVADLQDAIYAKTKKYYPARQRLTLPIQPGKSGKPV
VLSAKASLSEYCEKGSGSLTVVFKDLGPQVFYSTLFFFEYLGPLLIYPMFYYLPVYKYFG
YEGERVMHPVQTYAMYYWCFHYFKRIMETFFVHRFSHATSPVSNVFRNCAYYWTFGAYIA
YYCNHPLYTPVSELQMKIGFGFGILCQIANFYCHILLRNLRSPSGNGGYQIPRGFLFNIV
TCANYTTEIYQWLGFNIATQTVAGYIFLVVAASIMTNWALGKHRRLKKLFDGKEGRPKYP
RRWVILPPFL
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaaggtgtccgtcgtgtcccggagcggccgggaggtggtcaggggcggcgtcgagctc
aaggactcggctaaggtcgcggatctgcaggatgccatctatgccaagactaagaagtat
taccctgctaggcagcggctcaccctccctatccaacctggaaaatcaggaaagccagtt
gtccttagtgcaaaggccagcctatcagaatactgcgaaaagggttctggatccctgaca
gtggtctttaaggatttaggcccacaggtcttctacagcacgctgttcttctttgaatac
ttgggtcctcttcttatctaccccatgttctattacttgcctgtctacaaatatttcgga
tacgagggagagcgggtcatgcatcctgtccagacttacgccatgtactattggtgtttc
cactacttcaagaggatcatggagacgttctttgttcaccgcttcagccacgcgacttct
cctgtatcaaatgtcttcaggaactgtgcctactactggacctttggagcttacattgct
tactactgcaaccacccgctttacacccctgtgagtgaattgcagatgaagattgggttt
ggatttgggattctctgccaaattgcaaacttttattgccatatcctgctgaggaacctc
agaagtccgagtggtaacggtggctatcagattcctcgtggcttcctgttcaacatagtg
acatgcgcaaactataccactgagatctaccaatggcttgggttcaacattgccacacag
actgtggcaggttacatcttccttgttgtggcagcgagtatcatgaccaactgggcactt
ggaaagcaccgccgtctaaagaagttgttcgatggcaaggaagggaggccgaagtatcct
cggcgatgggtgattcttccaccattcctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324520
Entry
4324520           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324520
   01040 Biosynthesis of unsaturated fatty acids
    4324520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324520
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4324520
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324520
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 4324520
NCBI-ProteinID: XP_015644207
LinkDB
Position
1:2727783..2731563
AA seq 221 aa
MAADGSMVRRLYLSIYNWVAFIGWAQVLCYMTLALLDKGHEAVYAAIERPLLFTQTAAIL
EILHSIVGLVRSPVSSTLPQITGRLFITWGILWSFPETQSYIFVTSLLICWCIIEVTRYS
FYGMKESFGFTPSWLLWLRYSTFIACFPVGVVSEICLAYTVLPFMKASEKYCLRMPNKWN
FSFNYFYANVFFMAFYVPVVPYLFHHMIAQRKKALSKAKTT
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcagcggatggttcaatggtgcggaggctctacctctctatctacaattgggtcgcc
ttcatcggatgggctcaggtgttgtgctacatgaccttggcattgctggataagggacat
gaggccgtctatgctgccatcgagcgacctctgctgttcacgcagactgctgccatcttg
gagattcttcattccattgtagggttggtgaggtctccagtgtcttctactctcccacaa
attactggaaggttgttcattacctggggcatcttgtggagcttccctgagacacagtct
tatatttttgttacctccttgctcatatgctggtgcatcattgaggttaccagatattct
ttctatggcatgaaggagtcatttggatttacaccttcctggctcttatggcttaggtac
agcaccttcatagcatgctttcctgttggtgtggttagtgagatttgcctagcctacact
gttcttcctttcatgaaggcgtctgagaaatactgccttaggatgcccaacaaatggaat
ttctccttcaactacttctatgccaatgtctttttcatggctttttatgtcccagtggtt
ccatacttgtttcaccatatgatcgcccagcggaagaaggccttgtcaaaggcaaaaacc
acataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324521
Entry
4324521           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324521
   01040 Biosynthesis of unsaturated fatty acids
    4324521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324521
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4324521
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324521
SSDB
Motif
Pfam: PTPLA DUF2523 Phenol_monoox
Other DBs
NCBI-GeneID: 4324521
NCBI-ProteinID: XP_015645941
UniProt: Q5ZEI3 A0A0P0UYF0
LinkDB
Position
1:2741454..2747429
AA seq 225 aa
MPEEAAGMASVLRRLYLSVYNWIVFIGWVQVSWSMILALLEKRYEAVYAAVEQHLLFAQT
AAIMEILHSIVGLVRSPVSSTLPQITARLFMIWGILRSFPEIHTHIFVTSLLISWCITEV
TRYSFNGMKESFGFTPSWLLWLRYSTFIVCFPIGMVSEVGLVYIVVPFMKASEKYCLRMP
NKWNFSIKYFYASVFFMALYAPVYPHLFHYLIVQRKKALAKSKTT
NT seq 678 nt   +upstreamnt  +downstreamnt
atgcccgaagaagctgctgggatggcgtcagtcttgcggaggctctacctctctgtctac
aactggattgtcttcatcggatgggttcaggtgtcgtggtccatgatattggcattgttg
gagaagagatatgaggccgtctacgctgctgtagagcagcatctgctgttcgcgcagact
gctgccatcatggagattcttcattccattgtagggttggtgaggtctccagtgtcttct
actcttccacaaattactgcaaggttgttcatgatctggggcatcttgcggagcttccct
gagatacacactcatatttttgttacctccttgctcataagctggtgcatcactgaggtt
accagatattctttcaatggcatgaaggagtcatttggatttacaccttcctggctctta
tggcttaggtacagcaccttcatagtatgctttcctattggtatggttagtgaggttggc
ctagtctacattgttgttcctttcatgaaggcatctgagaaatactgccttaggatgccc
aacaaatggaatttctccatcaaatacttctatgcctctgtctttttcatggctttgtat
gccccagtatacccgcacttgttccactatttgatcgtccagcggaagaaggccttggca
aaatcaaaaaccacataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324522
Entry
4324522           CDS       T01015                                 
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A-like
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324522
   01040 Biosynthesis of unsaturated fatty acids
    4324522
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324522
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     4324522
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324522
SSDB
Motif
Pfam: PTPLA Phenol_monoox
Other DBs
NCBI-GeneID: 4324522
NCBI-ProteinID: XP_015624901
LinkDB
Position
1:2752062..2761619
AA seq 254 aa
MLVHLGGVEYPGQSHQPSRRFLPSRIFPAMAGNASGVRRLYLSLYNWIVFIGWVQVSWFM
ILALLKNGYEAVYAAVEQHLLFAQTAAIMEILHSIVGLVRSPVPSTVLQVTGRLFMIWGI
LWSFPETHSHILVTSLIICWCITEVTRYSFHGMKESFGFTPSWLFWLRYSTFIVCFPVGM
VCEVVLIYIALPFMEMKAQQYQASEKSDKWSFSFNYFYANLFFMASFATVYPVLFRYLIA
LRKKALAKAKPHNY
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcttgtacatcttggaggagtagagtatcccggtcaaagccatcagccatctcgacgt
tttcttccatctcgcatatttcctgcaatggcagggaatgcgtcaggggtgcggaggctc
tacctctctctctacaactggattgtcttcatcggatgggttcaggtgtcgtggttcatg
atattggcattgctgaagaacggatatgaggccgtgtatgctgccgtagagcagcatctg
ctgttcgcgcagactgctgcaatcatggagattcttcattccattgtaggtttggtgagg
tctccagtgccttctactgttctacaagttactggaaggttgttcatgatctggggcatc
ttgtggagcttccctgagacacactctcatatccttgttacctccttgatcatatgctgg
tgcatcactgaggttaccagatattctttccatggcatgaaggagtcatttggatttaca
ccttcctggctcttttggcttaggtacagcaccttcatagtatgctttcctgttggtatg
gtttgtgaggttgtcctaatctacattgctcttcctttcatggagatgaaggctcaacaa
tatcaggcatctgagaaatccgacaaatggagtttctccttcaactacttctatgccaat
ctctttttcatggcttcgtttgccacagtatatccagtcttgtttcgctacttgatcgcc
ctgcggaagaaggccttggcaaaagcaaaaccacataactactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324844
Entry
4324844           CDS       T01015                                 
Name
(RefSeq) stearoyl-[acyl-carrier-protein] 9-desaturase 1, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4324844
   01040 Biosynthesis of unsaturated fatty acids
    4324844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324844
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4324844
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4324844
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4324844
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4324844
SSDB
Motif
Pfam: FA_desaturase_2
Other DBs
NCBI-GeneID: 4324844
NCBI-ProteinID: XP_015630103
UniProt: Q8LJJ9
LinkDB
Position
1:38224372..38225994
AA seq 381 aa
MQVVGTVRVSGCGAVVAPSRRQCRVSAAVLTAAETATATRRRVTHSMPPEKAEVFRSLEG
WARSSLLPLLKPVEECWQPTDFLPDSSSEMFEHQVHELRARAAGLPDEYFVVLVGDMITE
EALPTYQTMINTLDGVRDETGASACPWAVWTRTWTAEENRHGDILGKYMYLSGRVDMRMV
EKTVQYLIGSGMDPGTENNPYLGFVYTSFQERATAVSHGNTARLARAHGDDVLARTCGTI
AADEKRHETAYGRIVEQLLRLDPDGAMLAIADMMHKRITMPAHLMHDGRDMNLFDHFAAV
AQRLNVYTARDYADIVEFLVKRWKLETLETGLSGEGRRARDFVCGLAKRMRRAAERAEDR
AKKDEQRKVKFSWIYDREVIV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgc
cggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcgg
cgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaaggg
tgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacg
gacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcg
cgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgag
gaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagacc
ggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgc
cacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtc
gagaagaccgtccagtacctcatcggctccggcatggatccggggacggagaacaacccg
tacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaac
acggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatc
gccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcgg
ctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatg
cccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtg
gcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtc
aagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgg
gacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagg
gctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgatt
gtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327738
Entry
4327738           CDS       T01015                                 
Name
(RefSeq) stearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4327738
   01040 Biosynthesis of unsaturated fatty acids
    4327738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4327738
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4327738
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4327738
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4327738
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4327738
SSDB
Motif
Pfam: FA_desaturase_2 Exonuc_V_gamma
Other DBs
NCBI-GeneID: 4327738
NCBI-ProteinID: XP_015622023
UniProt: Q8S059 A0A0N7KEB1
LinkDB
Position
1:complement(40146777..40150895)
AA seq 400 aa
MASRMALRPNDVTLRLTPPLAAAARRNRRAAAGGVRVYAVASGAVSTKVENKKPFAPPRE
VHVQVTHSMPPQKIEIFKSLDDWARDNILSHLKPVEKCWQPQDFLPDPASDGFHDEVKEL
RERAKEIPDDYFVCLVGDMITEEALPTYQTMLNTLDGVRDETGASPTAWAVWTRAWTAEE
NRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPRTENNPYLGFIYTSFQERATFISH
GNTARHAKDFGDLKLAQICGIIASDEKRHETAYTKIVEKLFEIDPDGTVLAFADMMKKKI
SMPAHLMFDGEDDKLFEHFSMVAQRLGVYTAKDYADILEFLVSRWKISDLTGLSSEGNKA
QDYLCTLAARIRRLDERAQSRAKKAGTLPFSWVYGREVQL
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcgtcgaggatggcgctccggcccaacgacgtcacgctccgcctcaccccgcccctc
gccgccgccgcgcggcgcaaccgccgcgccgccgccggcggtgtcagggtctacgccgtc
gcgtccggggccgtctccaccaaggttgagaacaagaagccatttgctcctccacgagag
gtgcacgtccaggttacacattccatgccaccccagaagattgaaatattcaagtctctt
gatgattgggccagagataatattttgtcccaccttaagcctgtcgagaaatgttggcaa
ccacaggattttcttcctgatccagcctcagatgggtttcatgatgaagtcaaagaactt
agagaacgtgccaaggaaattcctgatgattattttgtttgtttggttggagacatgatt
acggaggaagctcttcctacgtaccagactatgcttaacactctcgatggtgtccgagat
gaaacaggtgcaagccccactgcctgggctgtttggacaagggcatggactgctgaggag
aacaggcatggtgacctcctgaacaaatatctctacctcactggtagggtggacatgaga
caaattgagaagacaattcagtatcttattggctctggaatggaccctaggacagagaac
aatccttatcttggattcatctacacctccttccaagagcgtgcgaccttcatctcacat
gggaacactgctcgccatgccaaagactttggcgacctaaaacttgcacagatctgtggc
atcatcgcctcagatgagaagcgtcatgagactgcatacaccaagattgttgagaagctg
tttgagattgaccctgatggcactgtgcttgcttttgctgacatgatgaagaagaagatc
tcgatgcctgcccacctgatgttcgatggggaggatgataagctctttgagcacttctcc
atggttgcacagaggcttggtgtttacaccgccaaggactacgccgacatccttgagttc
ctcgttagcaggtggaagatatctgacctgactggcctatctagcgagggaaacaaggcg
caagactacctttgcacccttgctgctaggatcagaaggctggatgagagggcacaatcg
agagccaagaaagctggtacattgcctttcagctgggtatatggtagggaagttcaactc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329432
Entry
4329432           CDS       T01015                                 
Name
(RefSeq) acyl-[acyl-carrier-protein] desaturase 3, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4329432
   01040 Biosynthesis of unsaturated fatty acids
    4329432
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4329432
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4329432
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4329432
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4329432
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4329432
SSDB
Motif
Pfam: FA_desaturase_2
Other DBs
NCBI-GeneID: 4329432
NCBI-ProteinID: XP_015623425
UniProt: B9F058
LinkDB
Position
2:complement(17952014..17957566)
AA seq 402 aa
MSLTGCLPPRPPCSMRRRTSGGGASVSPVVAMASTAGVGGIGNPTPRGKKPFAPWREVPP
QVTHTLPPEKKEVFDSLEGWAADTILPYLKPVEESWQPQDHLPDPRSPSFGDEVAALRER
AAGLPDDHLVCLVGDMVTEEALPTYQTMLNTMDGGVRDETGAGGSAWAVWTRAWAAEENR
HGDLMNKYLYLTGRVDMRQVEKTIQYLIGSGMDPRTENDPYMGFIYTTFQERATSISHGN
TARHAGRHGDAALARVCGTVAADEKRHEAAYAAIVAKLFEVDPDYTVRAFARMMRRKVAM
PARLMYDGADDRLFARFAAVAQRLGVYTAADYAGIIEFLVARWGVPGLAAGLSGEGRRAQ
DFVCSLGPRFRRMEERAQEAAKRAPPAAAAPFSWIHGRQVQL
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtctctcacgggatgcctccctcctcggccgccatgctcgatgaggaggagaaccagt
ggaggaggagcctctgtctctcctgtcgtggcgatggcgtccacggcaggagttggcggc
atcggcaaccccaccccgagaggcaagaagcccttcgccccgtggcgcgaggtgccaccc
caggtgacccacacgctgccgccggagaagaaggaggtcttcgactccctggaggggtgg
gcggcggacaccatcctcccctacctcaagcccgtggaggagtcgtggcagccgcaggac
cacctcccggacccgcgctcgccgtcgttcggcgacgaggtggcggcgctgcgggagcgc
gcggcggggctccccgacgaccacctggtgtgcctcgtcggcgacatggtcaccgaggag
gcgctccccacgtaccagacgatgctcaacaccatggacggcggggtgcgcgacgagacc
ggcgccggcggcagcgcctgggccgtgtggaccagggcgtgggccgccgaggagaaccgg
cacggcgacctgatgaacaagtacctctacctcaccggcagggtcgacatgaggcaggtc
gagaagacgatacagtacctcattggctccggcatggatccacgaacggagaacgacccg
tacatggggttcatctacacgacgttccaggagcgcgccacctccatctcccacggcaac
acggcgcgccacgcggggcgccacggcgacgccgccctggcccgcgtctgcggcaccgtc
gccgccgacgagaagcgccacgaggccgcctacgccgccatcgtcgccaagctcttcgag
gtggacccggactacacggtcagggccttcgcccgcatgatgcgccgcaaggtcgccatg
ccggcgcgcctcatgtacgacggcgccgacgaccgcctcttcgcccgcttcgccgccgtc
gcgcagcgcctcggcgtgtacaccgccgccgactacgccgggatcatcgagttcctcgtc
gcgaggtggggcgtccccggcctcgccgcggggctttccggcgaagggcggcgcgcgcag
gacttcgtctgcagcctcgggccgaggttcaggaggatggaggagagggcgcaggaggcg
gcgaagcgggcgccgcccgccgccgccgctccgttcagctggatccatggccgtcaggtg
cagctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329873
Entry
4329873           CDS       T01015                                 
Name
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4329873
   01040 Biosynthesis of unsaturated fatty acids
    4329873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4329873
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     4329873
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     4329873
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4329873
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 4329873
NCBI-ProteinID: XP_015626287
LinkDB
Position
2:complement(23241643..23244644)
AA seq 325 aa
MAGTCAHAEFFRAQPAWALALAGVGLLAAARAALRLALWLYAAFLRPGKPLRRRYGAWAV
VTGATDGIGRAMAFRLAASGLGLVLVGRSPDKLASVSEEIRGRYPRVEVRTFVLDFAADG
LAAGVEGLREAIRGLEVGVLVNNAGVSYPYARYLHEVDEELMRTLIRVNVEGLTRVTHAV
LPAMVERKRGAIVNIGSGSSSVMPSDPLYSVYAATKAYVDQFSRCLYVEYKSKGIDVQCQ
VPLYVATKMASIRKSSFFVPSADTYARAAIRHIGYEPRCTPYWPHSVMWFLISILPESLI
DSIRLGMCIKIRKKGQAKDAKKKAQ
NT seq 978 nt   +upstreamnt  +downstreamnt
atggccggcacgtgcgcgcacgccgagttcttccgcgcgcagccggcgtgggcgctggcg
ctggcgggcgtcggcctcctcgccgccgcccgcgccgcgctccgcctcgcgctctggctc
tacgccgcgttcctccgcccggggaagcccctgcgccgccgctacggcgcctgggcggtc
gtcacgggcgccaccgacggcatcggccgcgccatggcgttccgcctcgccgcctcgggg
ctcggcctcgtcctcgtcggccggagccccgacaagctggcctcggtctccgaggagatc
agggggaggtaccccagggtggaggtgcggacgttcgtgctcgacttcgccgccgacggc
ctcgccgccggggtggaggggctcagggaggccatccgtgggctcgaggtgggcgtgctc
gtcaacaacgccggtgtctcgtacccgtacgcccgctacctccacgaggtggacgaggag
ctcatgcgcaccctgatccgggtcaacgtcgagggcctcacgcgggtcacgcacgccgtg
ctcccggccatggtggagaggaagcgcggcgccatcgtcaacatcggctccggctcctcc
tccgtcatgccgtccgatccgctctactccgtctacgccgccaccaaagcttacgttgac
caattctcaagatgcctttatgttgagtacaagagcaagggtattgatgtgcaatgccag
gtgcccttgtatgtggcaacaaagatggcctctatcaggaaatcctcgttctttgtccca
tccgcggacacctacgcccgtgctgccattcgtcacataggctatgagccgaggtgcaca
ccgtactggccacactctgtaatgtggttcctgatctccattctccccgagtcactcatt
gacagcattcgcctgggaatgtgcatcaagatccgcaagaaggggcaagccaaagatgct
aagaagaaagcgcagtga

DBGET integrated database retrieval system